(data stored in ACNUC29543 zone)

EMBL: CP000521.PE531

CP000521.PE531       Location/Qualifiers
FT   CDS_pept        592377..593240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11002"
FT                   /protein_id="ABO11002.2"
FT                   /translation="MSKKFEDFNNPREKALQGMKDSIPASQWEENLQFLKQLRNKIAKL
FT                   PVSKHPAIEILNNGYLDKQTLTRIHLEYRHAIVQIFTDALLKAQFLTKQLEPKLHSGAK
FT                   MFPRVLLSLNILDEFGFRPGLDKDHYYLGNPEYAHYPLYEDLLNDYGLTEADRRNYKPS
FT                   KIADQVRTFLEASYDRYINVVALLAVAEEEVILFSPPLRQATKFVNIDVEGGGYYHVHG
FT                   VSTDETAEAADDDHQDDLWFALAQAITKDDYESLTQLCLDYCALWTEFWDAQIADVQFI
FT                   EEKKLA"
     atgtcaaaaa aatttgaaga ctttaataat ccaagagaaa aagcattgca ggggatgaaa        60
     gatagtattc ccgcttcaca atgggaagaa aacttacagt ttctcaaaca attaaggaat       120
     aaaattgcga aattaccagt aagtaaacac cctgcaattg aaatattaaa taacggttat       180
     cttgataaac aaaccctgac tcgtattcat ttagaatatc gtcatgccat tgttcagatt       240
     tttaccgatg ctttattaaa ggcgcagttt ctgacaaaac aattggagcc aaagcttcac       300
     tcaggcgcta aaatgtttcc acgggtgttg ttgagcttaa atatattaga tgaatttggt       360
     tttcgaccgg gtttagataa agatcattat tatttaggca accctgaata tgcacattat       420
     ccattatatg aagatttgct aaatgactat ggtttgactg aggctgaccg ccgtaattat       480
     aaaccttcaa aaattgcaga tcaggtgaga acatttttag aagcttctta cgatcgttat       540
     attaatgtgg tggcattatt ggcggtggca gaagaagaag ttattctttt tagcccacca       600
     ttgcgacaag caaccaagtt tgtaaatatc gatgttgagg gtggtggtta ttaccatgta       660
     cacggcgttt caacagatga aacagctgaa gctgctgatg atgaccatca ggatgacctt       720
     tggtttgcgt tggctcaagc cattaccaaa gatgattatg aaagcttgac tcaactatgt       780
     cttgattatt gtgcattgtg gactgagttt tgggatgcac aaattgccga tgtccaattt       840
     attgaagaaa agaaattggc ataa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page