(data stored in ACNUC29543 zone)

EMBL: CP000521.PE533

CP000521.PE533       Location/Qualifiers
FT   CDS_pept        596452..598041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11004"
FT                   /protein_id="ABO11004.2"
FT                   /translation="MPDPQNQQFWSKIAERPTEIQQQFWYGAEKLAKYLNDNPAMYKGY
FT                   MTYDTSKPDPNLSWWEKILFYSGQAHYNEAVTHYNTSKVIADQGSWLWGMLKGDFNKDP
FT                   SMSQIIVGGLISLIPVADQVCDIRDLIANFITLSDEKARTKDNYMALALTSVGIIPEVG
FT                   SAIKTIVKSSRAKDVSKVKLFKFMEYFEEALTKLKIKCPWGKAPEAWLRSRPWKGIATQ
FT                   AFNTLKNNIDRILSVINKCLIRFNGALKVALAKFQATLNHVLNTIKKYIDQLCDEVDKA
FT                   IGRLLPQQPLAMAHAGGGGKNAPTGRYEANVSSGKKTEASHRQKKETPPPPRKMKPKHV
FT                   VEPCLEPKKGLRNSWGKKTGKSQAELDAEFDRQLKRQEEGLNRLTVEEYQQNRQLYEKY
FT                   KRAGTGTQQQRIREDMQRQLEESEYKKLKTEQPQLSKGQIERMAENNAKKTLEGLDVLH
FT                   NPDMQLGGFDVKYDPKKPPTLDDFGHSGVNRSIGSQMAAKKRLANMDAAAAQAKAKGMG
FT                   KDAMDVELKRCK"
     atgccagatc ctcaaaatca acaattctgg tcaaagatcg cagaacgacc tacggaaata        60
     caacagcagt tttggtatgg cgctgaaaaa ttagcaaagt atctcaatga taatccagct       120
     atgtataaag gttatatgac ctatgataca agtaagcctg atcctaatct gtcatggtgg       180
     gaaaagatat tattttacag tggacaagct cactacaatg aggcggtgac ccactataac       240
     accagtaaag taatcgctga tcaagggagc tggttgtggg gcatgctcaa aggtgacttt       300
     aataaagatc cttcaatgtc tcagattatt gttggtggac tcataagtct tatacctgta       360
     gctgatcagg tgtgtgatat ccgcgatttg attgccaatt ttatcacctt gtcggatgag       420
     aaagcccgaa cgaaagataa ctatatggca cttgctttga caagtgtggg tatcattcct       480
     gaagttggtt cagcaatcaa aacgattgtg aaatcgagtc gggcaaaaga tgttagtaag       540
     gtcaagttat ttaagttcat ggagtatttt gaggaggctt taacaaagct caaaattaaa       600
     tgtccatggg gtaaggcacc agaggcatgg ttaaggtctc gaccatggaa aggcatagcg       660
     acacaagctt ttaatacttt aaaaaataat attgaccgaa tcctatctgt cattaataag       720
     tgtttgatac ggttcaatgg tgcattgaaa gttgccttag caaaatttca ggcaacccta       780
     aaccatgttt taaataccat caaaaagtat attgatcagt tgtgtgatga agtagataag       840
     gcaatcggtc gtttattacc tcaacagcca ttagcaatgg cacatgctgg tggcggtggt       900
     aagaatgccc ctacagggcg ttatgaggcc aatgttagtt ccggtaaaaa aacagaagcg       960
     agtcatcgtc aaaagaaaga aacacctcca ccaccaagga aaatgaagcc gaagcatgtg      1020
     gttgagccgt gtttggaacc gaaaaaaggg ttgaggaata gttggggtaa aaagactggt      1080
     aagtctcagg ctgaactaga tgccgagttt gaccgtcagc ttaagcggca agaggaaggg      1140
     cttaaccgtc taacggttga ggagtatcaa cagaacagac aactttatga aaagtataaa      1200
     cgggctggaa caggtactca gcaacaaaga atccgagaag atatgcaacg acagttagag      1260
     gaatctgaat ataaaaaatt aaaaacagag caacctcaat tatcgaaagg ccaaatagaa      1320
     agaatggctg aaaataatgc taaaaaaacg ttagaaggat tagatgtctt acataatcca      1380
     gatatgcaat taggtggttt tgatgtcaaa tatgatccta aaaagccccc tacactagat      1440
     gattttgggc atagtggtgt aaaccgttct attggctctc aaatggccgc aaagaagcgg      1500
     cttgccaata tggatgcggc ggcagctcaa gctaaagcga agggaatggg gaaagatgcg      1560
     atggatgttg aattgaagcg ttgtaagtaa                                       1590
//

If you have problems or comments...

PBIL Back to PBIL home page