(data stored in ACNUC29543 zone)

EMBL: CP000521.PE534

CP000521.PE534       Location/Qualifiers
FT   CDS_pept        598056..598916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11005"
FT                   /protein_id="ABO11005.2"
FT                   /translation="MNQEDIDYFYEKYGQPIDKVEVTEDIIKKYRGKLPESILEQWHLF
FT                   GFAGYLNGLYWITNPDDYAEVIYDWLEETPLPDDDVYHVLARSAFGELLIWGERNYGRY
FT                   YIKTMEGILHDNGEQLESAEFYGSDFFFLPKKNYLDYTDKNGNKLFDRAVKKLGVLKAD
FT                   EMYAFEPALALGGEESLQHLTKVNLPVHMKLLKQVTPLRLRTFEDLTAALYGTSYSVDD
FT                   LTSGQDAESQYQESVQAGEVCPRTGYWTTPAQPNTRHYCKKGEVLPEIKEQDWGEVYWY
FT                   WDGEN"
     atgaaccaag aagatattga ttacttttat gagaaatatg gtcaaccaat tgataaagtt        60
     gaggtgacag aggacatcat aaaaaaatat cggggtaaac tgcctgaaag tattttagaa       120
     caatggcatt tatttggttt tgctggttat ttgaatggtt tgtactggat tacgaaccca       180
     gatgattatg ctgaagtaat ttatgactgg ttagaggaga caccattgcc tgatgatgat       240
     gtttatcatg tattggcccg ttccgcattt ggtgagctat taatttgggg tgaacgtaat       300
     tatggtagat attacattaa aacaatggaa ggtatcctac atgacaatgg cgaacagcta       360
     gaaagcgctg agttttatgg tagtgatttt ttctttttac ctaaaaaaaa ttatctagat       420
     tacacagaca aaaatggcaa taaactattt gatcgtgctg taaaaaaatt aggtgtttta       480
     aaggcagatg aaatgtatgc atttgaacct gctttggcat taggtgggga agaatcatta       540
     cagcacctaa caaaagttaa tcttcctgtt cacatgaagc tactaaaaca ggtaactcca       600
     ttaagattga gaacttttga ggatcttacg gctgctctat atggtacatc gtatagtgtg       660
     gacgatttaa caagtggaca agatgctgag tcacaatatc aagaatctgt tcaagctgga       720
     gaagtttgtc ctagaacagg ttactggaca acgcctgcac aacccaatac acgccattat       780
     tgtaagaaag gtgaagttct tcctgaaatt aaggaacaag actggggtga agtgtattgg       840
     tattgggatg gtgagaactg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page