(data stored in ACNUC29543 zone)

EMBL: CP000521.PE535

CP000521.PE535       Location/Qualifiers
FT   CDS_pept        599043..600110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11006"
FT                   /protein_id="ABO11006.2"
FT                   /translation="MSITVNDQEIDWQKWLDLEITDENEFRDHHLLKQDYHENFDELVN
FT                   GLYSVTDGFSNYKNEKKFGGYIAAGHQRLRDTLDLMSLQYSAGGDIGFIKELYPYLLHW
FT                   TEEYAETSHLYNLSPDAGGRYVWHISLGTEDYWYIALRLICFGLLTGYADQMYQIMPII
FT                   DYVEATPEGQEKDGLVERLVAPFVTDRGTPPDEARRHLPYRKLIKVFNAAPEQRPALML
FT                   QYLESWYEASRREPYHDQHPQTDLRSGVSYYGYWSWEAAAVTWLLEIDDTLYRDHEFYP
FT                   KDLVDFARSQSNMVSDEEQSEHIKVKGGEVCIKTGYWITPARPDTRLYFTQGTTLPILS
FT                   ETDWGEVYWYWDGEN"
     atgtcaataa cagtcaatga tcaggaaata gattggcaaa aatggctaga cttggaaatt        60
     actgatgaga atgaatttag agatcatcat ttattaaaac aggattatca tgaaaacttt       120
     gatgagcttg taaatggatt gtattcggtt actgatggct ttagtaatta taagaatgaa       180
     aagaagtttg gtggatacat tgctgcgggt catcagcgtt taagagatac tttagatttg       240
     atgtctttgc aatattcagc gggtggggat attggcttta ttaaagagct ttatccttac       300
     ttactgcatt ggactgaaga atatgcagaa accagtcatt tatataattt aagccctgat       360
     gctggcgggc gttatgtctg gcatattagt ttaggtacag aggactactg gtatattgct       420
     ttacgtttga tctgtttcgg tttactgaca ggctatgctg accaaatgta ccagattatg       480
     ccgattattg actatgttga agctacacct gaagggcaag aaaaagatgg gttagttgag       540
     cgtctggttg ctccgtttgt aacagaccga ggcacaccac cagatgaagc cagaagacat       600
     ttaccttatc gaaagttaat caaggtgttt aatgctgcac ctgagcaacg cccagcgtta       660
     atgctgcaat atttagaaag ctggtatgaa gcaagccgtc gagagcctta tcatgatcaa       720
     catccacaaa ctgatcttag atcgggcgtt agctattatg gttattggtc atgggaggca       780
     gcagcagtaa cgtggctatt agaaatagat gatactttat atcgtgatca tgagttctac       840
     ccaaaagatt tggtggattt tgcgcggtca caatcaaata tggtttcaga tgaggaacag       900
     tccgagcata taaaagtaaa aggtggtgaa gtttgtatta aaacaggtta ttggattact       960
     cctgctagac ctgatacacg actttatttt acgcaaggta cgacattgcc aatactttca      1020
     gaaacagact ggggggaagt atattggtat tgggatggtg agaattaa                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page