(data stored in ACNUC29543 zone)

EMBL: CP000521.PE537

CP000521.PE537       Location/Qualifiers
FT   CDS_pept        601975..602265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3503"
FT                   /old_locus_tag="AS1_3503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3503"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89928"
FT                   /protein_id="ABS89928.1"
FT                   /translation="MVAAIALILAICVFVWKKPQSSSSSQENSASTQDHPVEKAEVLPY
FT                   LNLTETKANYAVPFCEKKNCIDVDIQTIKTQDAWLNSWIRKKSGESYSSSN"
     gtggttgcag ccatagctct aattttggct atttgtgtat ttgtctggaa aaagcctcag        60
     tcttcatcat cttctcaaga aaattcagct tctactcaag accatccggt tgagaaagca       120
     gaggttttac cttatttaaa tttgaccgaa accaaagcaa attatgcagt gccgttttgt       180
     gaaaagaaaa attgtattga tgtcgatatt caaaccataa aaacccaaga tgcgtggtta       240
     aatagctgga ttagaaaaaa atcaggcgaa agttattcaa gctcaaatta a                291
//

If you have problems or comments...

PBIL Back to PBIL home page