(data stored in ACNUC29543 zone)

EMBL: CP000521.PE54

CP000521.PE54        Location/Qualifiers
FT   CDS_pept        61127..62422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0052"
FT                   /product="WecC protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10547"
FT                   /protein_id="ABO10547.2"
FT                   /translation="MQLADLRIAIIGLGYVGLPLAVEFGKKGPVVGFDINQNRIDELKS
FT                   GKDHTLEVSPEELQKAEQLSFSANLDDLKTSNFFIVTVPTPVDQVNRPDLTPLKKASET
FT                   VGQALKKGDIVVYESTVYPGATEEVCIPILEKVSGLKFNQDFFAGYSPERINPGDKVNT
FT                   LTKIKKITSGSTPEVANTVDAVYASIITAGTHKASSIKVAEAAKVIENTQRDLNIALVN
FT                   ELSVIFDRIGIDTLDVLEAAGSKWNFLPFRPGLVGGHCIGVDPYYLTHKAEEVGYHPQV
FT                   ILAGRRINDNMARYVARNTIKLMLQNGIDVPRSKVGVLGVTFKENCPDIRNSKVADLIK
FT                   ELEFWGAQVVVADPWADAEEVKHEYGVELGTVNAQNPVDSLIVAVGHSEFRSLSASELR
FT                   SYVKAEKPVLADVKSLFDRTQMSDVGFTVFRL"
     atgcaacttg ccgatttaag aatagcgatt ataggtttag gatatgtagg cttgccattg        60
     gcagttgagt ttggcaaaaa agggccggta gttggatttg atattaatca aaatcgtatt       120
     gatgaattaa agagtggaaa agaccatact ttagaagttt ctccagaaga gcttcaaaaa       180
     gcagaacaat taagttttag tgcaaactta gatgatttaa aaacgagtaa tttttttatt       240
     gtaacagtcc ctacacctgt ggaccaagtt aaccgaccag atttaacccc tttaaaaaag       300
     gcaagcgaga cagttggtca agctctaaaa aagggcgata ttgttgttta tgaatcaaca       360
     gtatatccag gtgctacaga agaagtatgt attccaatat tggaaaaagt atcgggactt       420
     aaatttaatc aggacttttt tgcaggatat agtcctgagc gtattaaccc aggagataag       480
     gttaatacac taaccaaaat taaaaaaatt acgagtggta gcacaccaga agtagctaat       540
     acggtggatg cagtgtatgc cagcattatt actgcaggta ctcataaagc ttctagtatt       600
     aaagtcgcag aagcagcaaa agttattgag aatactcagc gtgatttaaa tattgctttg       660
     gttaatgagt tatcggtaat ttttgaccgt attggtattg ataccttaga tgtgttggaa       720
     gcagcgggta gtaagtggaa ctttttgcct ttccgtcctg gtctggtagg tggacactgt       780
     atcggtgttg acccttacta cttgacccat aaagcagaag aggtaggtta tcatccgcag       840
     gtaattcttg ctggtcgtcg tattaatgac aatatggcgc gctatgttgc tcgtaatacg       900
     attaaactaa tgcttcaaaa tggtattgat gtgccacgct caaaagtagg ggtattaggg       960
     gtcacattta aagaaaactg tcctgatatt cgtaatagta aagtagccga tttaattaaa      1020
     gagcttgaat tttggggtgc acaggttgtg gttgcagacc cttgggctga tgcagaagaa      1080
     gttaagcatg aatatggtgt tgagcttggt accgtgaatg ctcaaaatcc agttgatagc      1140
     ctaattgtcg cagtaggcca tagtgagttc cgttctcttt ctgccagtga attacgtagc      1200
     tacgtaaaag ctgaaaaacc agttttagct gatgtgaaga gtctttttga ccgtacacag      1260
     atgtcagatg ttggttttac tgtattccgt ctctaa                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page