(data stored in ACNUC29543 zone)

EMBL: CP000521.PE540

CP000521.PE540       Location/Qualifiers
FT   CDS_pept        603814..604644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11010"
FT                   /protein_id="ABO11010.2"
FT                   /translation="MHLFDTHTHFDVADFDEDRHQLALEAKKVGVDALVLIGFLQSRFD
FT                   ELVQTHHQLKQWENVPASYLAPGLHPFYIEQHKPEHLSHLEQILQQEDCVAVGEIGLDT
FT                   FLKEHKQPDIYAKQKQYFADQLDLATQYQKPVLLHIRKAHGDVLALLKAHKFKLGGIAH
FT                   AFSGGVEEAKGLIKLGFKIGVTGQITNPNAKKLHTVVQTIGAEHLVIETDCPDMTPLCC
FT                   QTSTEQRTRNTPVNLPYVLKSLAVNLNMAESELADLLWKNSLSALKLIVIKIKD"
     atgcatctgt ttgatactca tacccatttt gatgttgccg attttgatga agatcggcat        60
     cagttagcac ttgaagctaa aaaagtgggt gtggatgctc tggtgttaat aggcttttta       120
     cagtcacgtt ttgatgagtt ggtacaaacc catcatcagc tcaagcagtg ggagaatgta       180
     cctgcttctt atttagcacc ggggttgcat ccgttttata ttgagcagca caaaccagag       240
     catctttctc atcttgaaca gattttgcag caagaagact gcgtcgcagt aggagaaatc       300
     ggcttagata ccttcttaaa ggaacacaag cagcccgata tatatgccaa gcaaaaacag       360
     tattttgctg atcagttaga tctggcaact caataccaaa aaccggtgtt gcttcatata       420
     cgaaaagcac atggtgatgt gctcgctcta ttaaaagcgc ataagtttaa actcggtggc       480
     attgctcatg cctttagtgg cggagtagag gaggcaaaag gcctgattaa acttggtttt       540
     aaaattggtg tgacgggaca aatcacgaat cccaatgcga aaaagcttca tacggttgtg       600
     cagactatag gtgctgagca tttagtgatt gaaacagact gtcctgatat gacgccactt       660
     tgctgtcaaa cttcaactga gcagcgtact cgaaatacgc ctgtgaattt accttatgta       720
     ctaaaaagtt tggctgtaaa tttaaatatg gcagagtcag aattagcaga tttgctgtgg       780
     aaaaactctt tatctgcttt gaaattaatc gtaataaaaa tcaaagatta g                831
//

If you have problems or comments...

PBIL Back to PBIL home page