(data stored in ACNUC29543 zone)

EMBL: CP000521.PE542

CP000521.PE542       Location/Qualifiers
FT   CDS_pept        607843..608604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0559"
FT                   /product="putative NAD(P)-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11012"
FT                   /protein_id="ABO11012.2"
FT                   /translation="MTDLQQDEYDRRFAGVAKIYGDSSFQHYEQSHVMVIGIGGVGSWA
FT                   VEALARTGIGEITLVDMDVVAASNVNRQLPAMTSTLGCEKVEIMAERCRQINPRIKVNI
FT                   IDDFLTPENVAELLNPVPDIVLDCIDDVKAKLALMLHCRFNKIPLIVSGGAGGKLDPLK
FT                   IRVADLSKTEQDPMLAKLRSQLRARGICKKPKEKFGITCIYSIDNPFSSADVCPSAGLR
FT                   CGGYGSAVVVTSSFAMIAVAEVLKKLDLKKA"
     atgaccgatc ttcaacaaga tgaatatgac cgccgttttg caggtgtagc caaaatttat        60
     ggtgattcat cgttccagca ctatgaacaa agtcatgtga tggtgattgg tattggtggg       120
     gtcggcagtt gggcggtaga agctttagcg cgtacaggta ttggtgagat cacattagtc       180
     gatatggatg tggttgcagc gtcaaatgta aaccgtcagc tacctgcaat gacctcaact       240
     ctgggctgtg aaaaagttga gattatggcg gagcgttgtc gccaaattaa cccacgcatt       300
     aaagtcaata ttattgacga cttcttaaca cctgaaaatg ttgcagagct tttaaaccct       360
     gtaccagaca ttgttttgga ctgcatcgat gatgtaaaag caaaactggc tttaatgctc       420
     cattgtcgtt ttaacaaaat tcctttgatt gtgtcgggtg gggcaggtgg taagctcgat       480
     ccacttaaaa ttcgcgtggc ggatctatca aaaacagaac aagacccaat gttagcgaag       540
     ttacgtagtc agcttcgtgc tcgtggcatc tgtaaaaagc caaaagagaa atttggcatt       600
     acctgtattt actcaatcga caatccattt tcaagcgcag atgtctgccc atcggcgggg       660
     ttgcgctgtg gtggctatgg ttcagcggtg gtggtgactt caagctttgc tatgattgct       720
     gtagccgaag ttttgaaaaa actcgattta aagaaagcct aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page