(data stored in ACNUC29543 zone)

EMBL: CP000521.PE544

CP000521.PE544       Location/Qualifiers
FT   CDS_pept        complement(609794..610303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11014"
FT                   /protein_id="ABO11014.2"
FT                   /translation="MIIYDGQVADNYMYQDSNQAAIVVSHSTPSLPYPFTMKPNNHSTE
FT                   TNTPPAIDVEKFVAKLESITSRRSKARCARSIRIALESAGADVENHPIAASDWGDTLKK
FT                   IGYKEINPAFDEPQEGDIYIIHRTRNHIYGHIAGYTGSEWVSDFKQSSYDVYKDDNVTY
FT                   TYYRLG"
     atgattattt atgacggaca agtagctgat aactatatgt atcaggattc aaatcaggca        60
     gccattgttg tatcccacag cacaccaagc ctcccttatc cattcaccat gaaacccaat       120
     aatcactcca ctgaaaccaa cactcctcca gccattgatg tagaaaaatt cgtagctaaa       180
     ttagaaagta ttacctctag acgcagtaaa gcgcgttgtg cacgtagcat ccgtattgcg       240
     cttgagtctg ctggtgccga tgttgaaaat catccgattg cagcatctga ttggggcgat       300
     accctcaaga aaattggcta taaagaaata aatccagcct ttgatgagcc acaagaaggc       360
     gacatttata tcattcacag aacccgcaac catatttacg gccatatcgc tggttacaca       420
     ggaagcgaat gggtgtcgga ctttaaacaa agtagttatg acgtctataa agatgataac       480
     gtcacctata cttactatag attaggctaa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page