(data stored in ACNUC29543 zone)

EMBL: CP000521.PE547

CP000521.PE547       Location/Qualifiers
FT   CDS_pept        complement(612994..613401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11017"
FT                   /protein_id="ABO11017.1"
FT                   /translation="MNKEIFKIINPSTLYDPIPNAYSHVAVVSNFNNIIHIAGQGGEDQ
FT                   QGQLSSHFSEQVLQAFENINYALVAANAELTDIAVLRILVVDHSVEKHEILIKIMKDLW
FT                   KNHPFPACTLIPVPRLALEHMLIEVEATAYT"
     atgaacaaag aaatttttaa aatcataaat ccttctactt tatatgaccc aatacctaac        60
     gcttatagtc atgtcgctgt agtaagtaat tttaacaata ttattcatat tgcaggtcaa       120
     ggtggcgaag accaacaagg tcaattaagt tctcatttca gtgaacaagt cctacaagca       180
     tttgaaaata ttaactatgc gttagtggct gccaatgcag agcttacgga tatcgctgtt       240
     ttaagaattc tagttgttga ccattcggta gaaaaacatg agattttgat taaaattatg       300
     aaggatttat ggaaaaatca tccttttcca gcctgcacac tcattcctgt gccgcgtctt       360
     gcactagaac atatgctcat tgaagtcgaa gcaacggcat acacttaa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page