(data stored in ACNUC29543 zone)

EMBL: CP000521.PE549

CP000521.PE549       Location/Qualifiers
FT   CDS_pept        614633..615760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0566"
FT                   /product="pyridine nucleotide transhydrogenase (proton
FT                   pump) alpha subunit (part1)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11019"
FT                   /protein_id="ABO11019.2"
FT                   /translation="MQIGIPTETVVGENRVAATPETVKKLISAGHSVVIERGAGVKAAY
FT                   IDSAYEQVGATITDDAYTGSQIILKVRAPQGGEIQKLAANTTVVAMFDPYRNTELDQFA
FT                   NQQVSAFALELLPRTLSRAQNMDVLSSQANLAGYKSVLLAAAEYQRMFPMLMTAAGTVK
FT                   PARVVIMGVGVAGLQAIATAKRLGAIVEATDLRPTAKDQVESLGGKWLDVPMSEEEQQR
FT                   AADAAKNGYGWMPGEQYIKDQAAIVDKAVSNADIVITTALLPGRDAPRLIKAETVAKMK
FT                   PGSVILDMAVETGGNVEGSKVGETVVTENGVKILGIPNIPATVATEASALYARNVFNFV
FT                   ETLFDKDKNFAINQEDEIQKALLVTHGGQVLLKRG"
     atgcagatcg gaatcccaac cgaaactgtc gtcggtgaaa atcgtgtagc tgctacgcca        60
     gagacagtaa agaagttgat tagcgctggt catagcgttg tgattgaacg tggtgctggt       120
     gtaaaggctg cgtacattga cagtgcttat gaacaggtcg gtgcaaccat tacggatgat       180
     gcctatacag gtagtcaaat tattttgaaa gttcgtgcgc cacaaggcgg ggaaattcaa       240
     aaacttgcag caaatacaac tgttgtagca atgtttgatc cttatcgtaa taccgagcta       300
     gaccaatttg cgaatcagca agtgtctgct tttgctctgg aattgcttcc tcgtacgctt       360
     tctcgtgcac aaaacatgga tgtgttgtct tctcaagcaa acttagctgg ttataaatca       420
     gttttgcttg cagctgctga atatcagcgc atgttcccaa tgcttatgac tgctgctggt       480
     actgtaaagc ctgcacgtgt tgtgattatg ggtgttgggg tggcaggcct tcaagcgatt       540
     gctactgcaa aacgtttggg tgcaattgtt gaagcaacag atttacgtcc aacggcaaaa       600
     gatcaggttg agtctttagg cggtaagtgg ttagacgtac caatgtctga agaagaacag       660
     caacgtgcag cagatgcagc aaaaaatggt tatggctgga tgccgggtga gcaatacatc       720
     aaagaccaag ctgcgattgt agataaagct gtgtcgaatg ccgatatcgt gattacaaca       780
     gcattgttac caggtcgtga tgcaccgcgt ctgatcaaag ctgaaactgt tgccaaaatg       840
     aaaccaggct ctgtcatttt agatatggca gttgaaacag gcggtaacgt tgaaggttct       900
     aaagttggcg aaactgttgt cactgaaaat ggcgtaaaaa ttttgggtat tccaaatatt       960
     ccggccactg ttgcgacaga agcttctgca ttatatgcac gtaacgtttt taatttcgta      1020
     gagactttat tcgacaaaga caaaaacttt gcgattaatc aagaagacga aatccaaaaa      1080
     gccctattgg tcactcatgg cggtcaagtg ctgcttaagc gtggttaa                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page