(data stored in ACNUC29543 zone)

EMBL: CP000521.PE55

CP000521.PE55        Location/Qualifiers
FT   CDS_pept        62453..63403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0053"
FT                   /product="MviM protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10548"
FT                   /protein_id="ABO10548.2"
FT                   /translation="MKKFALIGAAGYIAPRHLKAIKETGNTLAVAMDVNDSVGIMDSHF
FT                   PEAEFFTEFEEFEAYVEDQKLKGEKLDYVAICSPNYLHAPHMKYALKNGIDVICEKPLV
FT                   LNSEDLNMLAEYEKQYGAKVNSILQLRLHPSIIALRDKVQAAPADKVFDVDLTYLTSRG
FT                   KWYLKSWKGVDNKSGGVATNIGVHFYDMLHFIFGKIVKNEVHYRDEKTASGYLEYERAR
FT                   VRWFLSIDANNLPENAVQGEKLTYRSITIENEELEFSGGFTDLHTQSYQRVLEGKGYGV
FT                   EENRAAIETVEVIRVSPIIENPENPHPLLAKVKKA"
     atgaaaaaat ttgcattaat tggtgctgct ggttatatcg caccgcgtca cttaaaagca        60
     attaaagaaa ctggtaatac tttagcggtt gcgatggacg taaatgactc tgttgggatt       120
     atggatagtc attttcctga ggctgagttt tttacagaat ttgaagaatt tgaagcatat       180
     gtagaagatc aaaagttaaa aggtgaaaag ttggactatg tagcaatttg ctcacctaat       240
     tatttacatg cgccacatat gaaatatgct ttaaaaaatg gtatagacgt tatttgtgaa       300
     aagccattag ttttgaattc agaagactta aatatgttgg ctgaatatga aaagcaatat       360
     ggtgcgaaag taaactcgat tctacaacta cgcttacacc cgtctattat tgcactgcgt       420
     gataaagttc aagctgcccc agccgataaa gtatttgatg ttgacctcac ctatttaact       480
     tctcgtggta aatggtattt aaagtcatgg aaaggcgttg ataacaaatc tggtggtgta       540
     gcgacaaata ttggtgtgca cttctacgat atgttgcatt ttatttttgg aaaaattgta       600
     aaaaatgaag tgcattatcg cgatgagaaa actgcatctg gttatttaga atatgagcgt       660
     gcacgtgtac gttggttctt atcaattgat gctaataatc taccagaaaa tgcggtgcaa       720
     ggtgaaaaat taacttaccg tagtattact attgaaaatg aagaacttga attctcaggt       780
     ggttttaccg atttacatac tcagagctat caacgtgtat tagaaggtaa aggctacggt       840
     gttgaggaga accgcgcggc aattgaaacg gtcgaggtga tccgagtttc tccaattatt       900
     gaaaatcctg aaaatccaca tccactatta gcaaaggtga aaaaagcatg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page