(data stored in ACNUC29543 zone)

EMBL: CP000521.PE550

CP000521.PE550       Location/Qualifiers
FT   CDS_pept        615772..616086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0567"
FT                   /product="pyridine nucleotide transhydrogenase (proton
FT                   pump) alpha subunit (part2)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11020"
FT                   /protein_id="ABO11020.2"
FT                   /translation="MVETITIFVLAIFVGYYVVWGVTPALHTPLMAVTNALSSIIVVGA
FT                   MLQTVGLPVLGVDANVAFQSVNVVSVLGAIAVFLASINIFGGFAVTARMLEMFKPKQKK
FT                   "
     atggttgaaa ctattacaat tttcgtcctt gccatcttcg taggttatta cgttgtttgg        60
     ggtgttacac cagctttgca cacgccactt atggcagtaa ccaacgcatt gtcatcgatt       120
     attgttgttg gtgcgatgtt acaaacagtt ggcctgcctg tacttggtgt agatgcaaat       180
     gttgcatttc aaagtgtgaa tgttgtgagc gtacttggtg cgattgcagt atttttagca       240
     agcattaata ttttcggcgg cttcgcagta actgcacgca tgttggaaat gttcaagcct       300
     aagcaaaaga aataa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page