(data stored in ACNUC29543 zone)

EMBL: CP000521.PE559

CP000521.PE559       Location/Qualifiers
FT   CDS_pept        625651..626469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11029"
FT                   /protein_id="ABO11029.2"
FT                   /translation="MRFPTLVFDIETLTDLKAGAHLYHLDLPETDVEQALTKIRRQESG
FT                   MDFQRLPLHEIVCISGLWIDESGFRLFSFSREHYSEAEILQKFLSIFDKRHPTLVSWNG
FT                   SQFDLPVILFRAMYHGLSAPGLFDQGELDSQKRFNNYQNRYHHRHIDLMDVMAMFNGRN
FT                   FQKLDDVACILGLPGKRGESGYHVPEYVRTEQWLKLTSYCEGDVLNTWFIYLRWLLLKG
FT                   QMNVDEHNHWISSSIEYLQTMPQQADFLEVWQRTSKHTEFTSHYFNPLNF"
     atgcgttttc ctactttagt ttttgatatt gaaactttaa ctgatttaaa agcgggagcg        60
     catttatatc atcttgattt gccagagaca gatgttgaac aggcactcac aaaaatccgt       120
     cgccaagaat ccggcatgga ttttcagcgt ttgcctttac atgaaatcgt ttgtatttct       180
     ggtttgtgga ttgatgaatc aggtttcaga ttattttctt ttagtcggga acactattcg       240
     gaagctgaaa ttttacagaa atttctatcc atttttgata agcgtcatcc aactttagtg       300
     agctggaatg gttcgcaatt tgatttgccc gtcattttgt tccgtgccat gtatcatggt       360
     ctttcggcac ccgggttatt tgatcaaggc gagcttgata gtcagaagcg ttttaataat       420
     taccaaaacc gttatcacca ccgtcatatt gatttaatgg atgttatggc aatgtttaat       480
     ggccgtaatt tccagaaact cgatgatgta gcctgtattt taggtttacc aggtaaacgt       540
     ggtgagtcgg gttatcatgt gcctgaatac gtccgtacag aacaatggtt aaaattaacc       600
     agttattgtg aaggtgatgt gctcaataca tggtttattt atttgcgttg gctattgctc       660
     aaaggccaaa tgaatgtaga tgagcataac cactggatta gttcgagtat tgagtattta       720
     cagactatgc ctcagcaagc cgattttctt gaggtgtggc aacgtacatc gaaacatacc       780
     gaatttacgt cccactattt taatccttta aatttttag                              819
//

If you have problems or comments...

PBIL Back to PBIL home page