(data stored in ACNUC29543 zone)

EMBL: CP000521.PE562

CP000521.PE562       Location/Qualifiers
FT   CDS_pept        631136..631942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0581"
FT                   /product="hypothetical protein (MazG family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11032"
FT                   /protein_id="ABO11032.2"
FT                   /translation="MDKLLKIMQELREKCPWDQEQTPMSLTKYAIEEAYEVEAAIRQGD
FT                   INEIRNELGDLLLQVVFQSQMFSEQGAFNFQDVVEAISEKLVRRHPHVFQADQFNNLTP
FT                   EQVSELWKQIKQQEKQGKPQSRLDEIKHGPALSQAQEIQKNVAKVGFDFETVEDAYTKL
FT                   EEELDEFKQALKNQNSDEIQDEFGDCLFSLVNVGRKLGISSESSLLSTIHKFRSRFAFI
FT                   EEQAIKQQRTLEDMTLSEMDELWNQAKRQLKSGEKPHAIQHEILEK"
     atggataaat tgcttaaaat tatgcaagag ctacgtgaaa aatgtccgtg ggaccaagag        60
     caaactccaa tgtcactgac taaatatgcg attgaagagg catatgaagt cgaggctgcc       120
     attcgtcaag gtgacattaa tgaaattcgg aatgaattgg gtgatctgtt attacaagtg       180
     gtatttcaat cgcaaatgtt tagcgagcag ggggcgttca attttcaaga tgtggttgag       240
     gcaattagcg aaaaattagt acgacgccat ccgcacgttt ttcaagcaga ccaatttaac       300
     aacttaacac cagaacaagt aagtgagtta tggaaacaaa ttaaacaaca agaaaagcaa       360
     ggaaaaccac aatcaagatt agatgaaatt aaacatggac cagcactatc tcaagcgcag       420
     gaaattcaaa aaaatgttgc aaaagttggg ttcgattttg aaacggtaga agatgcttat       480
     acaaaattag aagaagaatt agatgagttt aaacaggcac ttaaaaatca aaatagtgat       540
     gaaattcaag atgaatttgg agactgcctg ttttcattag tcaatgtagg acgtaaactt       600
     ggcatttcaa gtgaaagttc acttttatca accatacata aatttagaag tcgttttgct       660
     tttattgaag agcaagccat aaaacagcaa agaacattgg aagacatgac cttgtccgaa       720
     atggatgaat tgtggaatca ggcaaaacga caattaaaat caggggaaaa accacatgca       780
     atacagcatg agattttgga aaaataa                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page