(data stored in ACNUC29543 zone)

EMBL: CP000521.PE568

CP000521.PE568       Location/Qualifiers
FT   CDS_pept        635246..636094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0587"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /note="Pantothenate synthetase; Pantoate activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11038"
FT                   /db_xref="GOA:A3M294"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M294"
FT                   /protein_id="ABO11038.2"
FT                   /translation="MKTETTIQGLAASLNPARAARKIIGFVPTMGNLHEGHLTLVREAK
FT                   KLCDVVVVSIFVNPTQFGPGEDFDNYPRTLEQDSRLLADVGCDIIFAPSVEQMYGTQPR
FT                   LTNISVSQITDDLCGSSRPGHFDGVALVVTKLFNIVQPNYAFFGQKDYQQLAVIRQFVQ
FT                   DLNIPLEVIGVPIVRAEDGLALSSRNGYLTPEQRQVAPVIYQGLKQAEEQLHQGKDLQQ
FT                   VLADLKTLLTDNGFVVDYVEARQPNLLAASQFDRDIVLFVAAKLGGTRLIDNLQVAFTP
FT                   Q"
     atgaaaacag aaaccactat acaaggctta gctgcttctt taaatcctgc tagagctgca        60
     cgtaaaatca ttggttttgt cccaacgatg ggaaatctac atgaaggcca cctcactctt       120
     gttcgtgaag cgaaaaagtt atgtgatgtt gtggttgtga gtatcttcgt gaacccaaca       180
     cagtttggtc cgggtgaaga ttttgataat tatccgcgta cgttagagca ggatagtcgt       240
     ttacttgcag atgttggctg tgacattatt tttgcaccat cagttgaaca aatgtacggt       300
     acacaacctc gcttaactaa cattagcgtc agtcaaatta cggatgattt atgtggaagc       360
     tcacgtccgg ggcattttga tggcgtggca ctggttgtca ccaaactctt taatattgtg       420
     caaccgaatt atgctttctt tggtcaaaaa gactaccagc aattagcagt gattcgccag       480
     tttgtacagg atttgaatat tccgttagaa gttattggcg taccaattgt tcgtgcagaa       540
     gacggtttgg cactgagttc aagaaatggt tacttgactc ctgaacagcg tcaggttgca       600
     ccagtcattt atcaaggttt aaaacaagcc gaagagcaat tacaccaagg taaagattta       660
     caacaagtct tggcagattt gaaaacactg ttgacagaca atggttttgt tgtggattat       720
     gtggaggctc gtcaacctaa tttgttagct gcttctcaat ttgatcgtga tattgtgttg       780
     tttgtcgcgg caaaattagg tggaacgcgc ttaattgata atctacaagt tgcctttaca       840
     cctcaataa                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page