(data stored in ACNUC29543 zone)

EMBL: CP000521.PE569

CP000521.PE569       Location/Qualifiers
FT   CDS_pept        636117..636968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11039"
FT                   /db_xref="GOA:A3M295"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M295"
FT                   /protein_id="ABO11039.2"
FT                   /translation="MKRILIVTGQSGSGKSSALQVLEDLGYYCIDNLPLALLPEIVAKL
FT                   DHENNLEQLALGVDVRSTRADMQEFDHVFEQLQKHGTVDVIYLTTQDQDLIARFSASRR
FT                   PHPLANRFKSLLQCIHEEKQLLIPIQFRATVHIDTTDKSVHDLKHILLSKLGQSDNLIV
FT                   ILQSFGYKHGIPLDADYVFDVRHLPNPHWDLELRRFSGLDEPVKQFLEASPQANEMFED
FT                   ILHFLKKWLPAFAEGHRHYMTISIGCTGGQHRSVYMVDRLKQALEAEWSVQVLHREMKH
FT                   WS"
     atgaagcgta tacttatcgt gacaggacag tctggttcag gaaaatcttc agctcttcaa        60
     gtattagaag atttgggcta ctactgtatt gataatttac ctttggcatt gctgcctgaa       120
     attgtggcaa agctagatca tgaaaataat cttgagcagc ttgctttagg ggtggatgta       180
     cgaagtactc gggcagatat gcaagagttc gaccatgttt ttgagcaatt acaaaaacat       240
     ggtacggttg atgtgattta tctgacgaca caagatcaag atttgattgc acgatttagt       300
     gcttcacgtc gtccacatcc gttagcaaat cgtttcaaaa gccttttaca gtgtattcat       360
     gaagaaaagc agttgctgat tccaattcag tttcgtgcca ctgttcacat tgataccaca       420
     gataaaagtg ttcacgattt aaaacatatc ttgctatcaa aactaggaca gtcagataat       480
     ctgattgtta tattgcagtc atttggttat aaacatggca ttcctttaga tgccgactat       540
     gtttttgacg tacggcattt accaaatccg cattgggatt tagaattacg ccgcttttct       600
     ggtttagacg agccagttaa acaattttta gaagcaagtc cgcaagcaaa tgaaatgttt       660
     gaggacattc tccacttctt aaaaaaatgg ctgccggcat ttgctgaagg gcatcgtcac       720
     tatatgacga tttcaatagg ttgcacaggc ggccagcatc gttcagttta tatggtagat       780
     agactaaaac aagcacttga ggcagaatgg tctgttcagg tcttacacag agaaatgaag       840
     cactggtcat ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page