(data stored in ACNUC29543 zone)

EMBL: CP000521.PE57

CP000521.PE57        Location/Qualifiers
FT   CDS_pept        63980..65059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0055"
FT                   /product="WecE protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10550"
FT                   /protein_id="ABO10550.2"
FT                   /translation="MIDFIDLKAQQNRIKDKIDAGIQNVLTHGQYILGPEVIELEEKLA
FT                   SYVGAKHCITCANGTDALQIAQMAFGIGPDDEVITPGFTYIATAETVALLGAKPVYVDV
FT                   NPKTYNLDSEKLEAAITPRTKAIIPVSLYGQCADFDVINAIAKKYSIPVIEDAAQSFGA
FT                   TYKSRKSCNLSTVACTSFFPSKPLGCYGDGGAIFTNDDELAKVIRQIARHGQDKRYHHI
FT                   RVGVNSRLDTLQAAILLPKLEILDDEMQARQRVAEVYNRLFNEVGIHTTPYIEAHNTSA
FT                   WAQYTIQVDNRAEVQEKLKAQGIPTAVHYPIPLNKQPAVADSDIHLPIGDAIAEKVMSL
FT                   PMHPYLAIDDQLKIVKAFG"
     atgattgact ttattgattt aaaagcacaa caaaatcgaa ttaaagataa aattgatgct        60
     ggtattcaaa atgtattgac acatggtcaa tacattttag ggccggaagt aattgagcta       120
     gaagaaaagc tagcttcgta tgtgggtgct aagcactgta ttacttgtgc aaatggcaca       180
     gatgccctgc aaattgcaca aatggctttc ggtattgggc ctgatgatga agtgattact       240
     ccaggtttta cttatattgc tactgctgaa acagttgcac tcttaggtgc aaaacctgta       300
     tatgttgatg taaatccgaa gacttataat ttagatagtg aaaaattaga agctgcaatt       360
     acacctcgaa ccaaggctat tattcctgtg agtttatatg gccaatgtgc agactttgat       420
     gtaatcaatg caattgctaa aaagtatagt atccctgtaa ttgaagatgc tgcccaaagc       480
     tttggggcca catataaaag tcgtaaaagc tgtaacctaa gtacagttgc ttgtacgagt       540
     ttcttcccaa gtaaaccatt aggttgttat ggtgatggtg gcgctatttt taccaatgat       600
     gatgaactag ctaaagtgat tcgtcagatt gcacgtcatg gacaagataa gcgttatcac       660
     catatccgtg ttggtgtgaa cagccgctta gataccttgc aggcagcaat tttattacca       720
     aaattagaaa ttttggatga tgaaatgcaa gcacgtcaaa gagtagcgga agtttataac       780
     cgactattta acgaggtagg gattcatact acgccgtata ttgaagcgca taatacgagt       840
     gcatgggcac aatatacgat tcaagttgat aaccgtgcag aagtacaaga gaaattaaaa       900
     gctcaaggta ttccaacagc agtgcattat ccaataccac ttaataagca acctgctgta       960
     gcggatagtg acattcatct ccctattgga gatgcgattg cggagaaagt aatgagctta      1020
     cctatgcatc cctacttagc tattgatgat caattaaaaa ttgttaaggc ttttggttga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page