(data stored in ACNUC29543 zone)

EMBL: CP000521.PE570

CP000521.PE570       Location/Qualifiers
FT   CDS_pept        636965..637234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0589"
FT                   /product="phosphocarrier protein (HPr-like)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11040"
FT                   /protein_id="ABO11040.1"
FT                   /translation="MIDTTVDVINKLGLHARASGKLIEVTTKFRSSIQIGKGDHLVDAK
FT                   NIMSLLMLGAGKGTTLRLVIDGTDEEQALNEVQALFAAKFYEAD"
     atgatagaca caactgttga tgtaattaat aaactcggtt tacatgcacg tgcatcagga        60
     aaactgatag aggtcactac aaagtttcgt tcgtcaattc aaattggtaa gggcgatcat       120
     ttagtagatg caaagaatat tatgtcgtta ctgatgttag gtgcaggtaa agggactact       180
     ttacgtttag tcattgatgg cactgacgaa gaacaggcat taaatgaagt acaggcgtta       240
     ttcgccgcaa aattttatga ggcagattaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page