(data stored in ACNUC29543 zone)

EMBL: CP000521.PE580

CP000521.PE580       Location/Qualifiers
FT   CDS_pept        645851..646042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3505"
FT                   /old_locus_tag="AS1_3505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3505"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89930"
FT                   /protein_id="ABS89930.1"
FT                   /translation="MMIDEKFLNDLIQKIQQGHQFKYLYFWGHTPKKANLIDKSCFSQW
FT                   FPAQFNVEDIEYFTLSTI"
     atgatgatag acgaaaaatt tctaaatgac ttaattcaaa aaatacagca aggtcaccag        60
     ttcaaatatt tatatttctg gggacatact cctaagaaag ctaatcttat tgataaaagc       120
     tgttttagcc agtggtttcc tgcgcaattt aatgtagaag atattgaata ctttacgctg       180
     agcactatat ga                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page