(data stored in ACNUC29543 zone)

EMBL: CP000521.PE583

CP000521.PE583       Location/Qualifiers
FT   CDS_pept        complement(646976..647545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11051"
FT                   /protein_id="ABO11051.1"
FT                   /translation="MNEKLSKKVEADLKAPQWDEIANFMETELFRSKYAAGFEEPEFQK
FT                   KYFDGSTHQISVEHQPTLALIPESYPADCAHQLLYRTQALSDYLEQKKRTANDPLGEDL
FT                   DQEQIINLRNFTHKTDDLFAKLIVKAANHYQTAQLKPVEKPSPFDATNESAAHLKVPHH
FT                   KAGGTGVIKLIVLTIIICALAYYFGL"
     ttgaatgaaa aattatctaa aaaagttgaa gctgacttaa aagcacctca atgggatgaa        60
     attgcaaact ttatggaaac tgagttattt cgaagtaagt atgcagcagg ttttgaagaa       120
     ccagaatttc agaaaaaata ttttgatggg tcaacacatc aaatttcggt agagcatcaa       180
     ccaactcttg ctcttattcc tgaaagctac ccagcagatt gtgcacatca actcctctac       240
     cgcactcagg ctttatcaga ttatttagag cagaaaaaac gcaccgcaaa tgatccttta       300
     ggggaagact tagaccaaga acaaattatt aacttaagaa actttaccca caaaactgac       360
     gacctatttg caaaacttat tgtgaaagca gcaaatcatt atcaaacagc tcaattaaaa       420
     cctgttgaga aaccttctcc ttttgatgca acgaatgagt ccgcagctca tttaaaagta       480
     cctcatcaca aagctggagg aacaggggta atcaagctta ttgttctgac aatcattatt       540
     tgtgctttag cctattattt tggtctttaa                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page