(data stored in ACNUC29543 zone)

EMBL: CP000521.PE585

CP000521.PE585       Location/Qualifiers
FT   CDS_pept        649148..651529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0602"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11053"
FT                   /protein_id="ABO11053.2"
FT                   /translation="MKISENWLRTWVNPAIDSDTLSDQLTMLGLEVDELAPVAKPFTGV
FT                   VVGEVLTVEQHPDADRLRVTTVNIGSGEPLQIVCGAPNVRAGMKAPVATIGAILPGDFK
FT                   IKKGKLRGVESQGMLCGASEIDLEDKIDGLLELPADAPVGVNIREYLKLDDNVIDISIT
FT                   PNRGDCFSIRGIAREVAVINQLQMNEPEIKSVDATITDEKKVVINTDGAPRYLGRVIKN
FT                   VNVKAATPEWMEQALARSGIRTHSILVDITNYVLMELGQPMHAFDLAKIEGTVHVRQAK
FT                   PKEKLQLLNDQEVELQDDVMVIADDQKALAIAGIMGGLASSVTDDTTDIFLESAFFAPL
FT                   AIAGRARRFGLHTDSSQRYERGVDFELPLIAMNRASQLIQELAGGEFGPITVAEKSDLL
FT                   PKREAIELKQAQVDQLLGYKVAAEFITDALTRLGCEVTVQADGEWSVVPPSHRYDMAIY
FT                   QDLIEEVARIDGYDNIQISLPSMDVQLAKYQDRFEIAQLRQTVVTLGYQEAISFSFADA
FT                   KLEKQLNPQVSPLMLANPISSDLAAMRSTLLSSLIPCVQYNLNRQQSRVRFFELGLRFD
FT                   YQNANSIQDLKQIPTLALVAVGSREPESWHAKPQPMDFFDFKGEVEEILAAGRVKVEYV
FT                   RSERPWLHPGQSAEILVDGQSIGYLGRLHPSLENELDLSTTWVAELDQAAVLQSYVSNF
FT                   TELSRFPSVRRDIALLISDNINVRDIQQLIEKTGGELLDSTWLFDVYTGQGVEEGKRSL
FT                   AFALLWQHPSRTLEDAEIKSGMDNIIQVLENTYQATLRAS"
     atgaagatta gcgaaaattg gttacgcaca tgggttaatc cagcaattga tagtgataca        60
     ttatctgatc agttgactat gcttggtctt gaagtagatg agctggcacc tgttgctaag       120
     ccatttactg gcgttgtagt tggtgaagtt ctaacagttg aacagcaccc tgatgcagac       180
     cgtctgcgtg taacaacagt gaatattggt tcaggtgagc ctttacaaat tgtatgtggt       240
     gctcctaacg ttcgtgctgg aatgaaagca cctgtggcaa ctattggtgc aatattaccg       300
     ggtgatttta aaatcaaaaa aggtaagctt cgtggtgtcg agtcacaagg tatgttgtgc       360
     ggtgcttctg aaattgacct tgaagataaa atcgatggtt tacttgagtt acctgccgat       420
     gctccagtag gggtaaatat ccgtgaatac ttaaaacttg atgataatgt catcgatatt       480
     agtattacac caaaccgtgg tgactgcttt agtattcgtg gtatcgcacg tgaagttgca       540
     gtgattaacc aactgcaaat gaatgagcct gaaatcaaat cagttgatgc gacaattact       600
     gatgagaaaa aagtagtcat caacactgat ggtgctccac gctacttagg acgtgtcatt       660
     aaaaatgtaa atgttaaagc tgcgacccca gagtggatgg aacaagcttt agcacgttca       720
     ggaattcgta ctcatagtat tttagttgat ataacgaact atgtcctcat ggaattgggt       780
     cagccaatgc atgctttcga tttagctaaa atcgaaggaa ctgtacacgt tcgccaagct       840
     aagccgaaag aaaagttaca gcttttgaat gatcaagaag ttgaactaca agatgatgtg       900
     atggtgattg cagatgacca aaaagcacta gcaatcgctg gtatcatggg ggggctagca       960
     tcaagcgtaa ctgatgatac gactgatatc ttcttggaaa gtgcattttt tgctccgctt      1020
     gcgattgctg gacgtgctcg tcgctttggt ttacatacag attcttcaca acgttatgaa      1080
     cgcggtgtag attttgaatt gccgttaatt gcgatgaacc gtgcttctca gcttattcaa      1140
     gagttggcgg gtggtgagtt cggtccaatt actgtagctg aaaaatctga tttacttccg      1200
     aaacgtgaag cgattgaact taagcaagct caagtagacc agttgttggg ttacaaagta      1260
     gcggcagagt tcattacaga tgcattaact cgattaggtt gtgaagtcac tgttcaagcg      1320
     gatggtgaat ggagcgtagt tccaccatca catcgctacg atatggcaat ttatcaagat      1380
     ttgattgaag aagttgcacg tattgatggt tatgacaata ttcagatcag cttaccaagt      1440
     atggatgttc aacttgctaa gtaccaagac cgttttgaaa tcgcgcagtt acgtcaaacg      1500
     gtagtcactt tagggtatca agaagcgatt agctttagct ttgctgatgc aaaacttgaa      1560
     aagcaattga acccgcaagt aagtccgtta atgttggcaa atccaatctc tagtgatttg      1620
     gctgcaatgc gcagcacatt gctttcgagc ttaattcctt gtgtacaata taatttaaac      1680
     cgtcagcaaa gccgcgtacg tttctttgaa ctaggtttac gttttgatta tcaaaatgct      1740
     aattctattc aggatctgaa gcaaattcct acattggctt tagttgccgt aggttctcgt      1800
     gaacctgaat catggcatgc taagccacag ccaatggatt tcttcgattt taaaggtgaa      1860
     gtagaagaga ttttagctgc tggacgtgtc aaagttgagt atgtacgttc agagcgtcca      1920
     tggttgcatc cagggcaatc tgctgaaatc ttagttgatg gccaatcaat tggttacttg      1980
     ggccgcttgc atccatcttt agaaaacgaa ctagatttga gcacaacttg ggttgccgag      2040
     cttgatcagg ctgctgtttt gcaatcttat gtatctaatt ttacagaatt atcacgtttt      2100
     ccttcggtta gacgtgatat tgcgctttta atctctgata atataaatgt tagagatatt      2160
     cagcagttaa tcgaaaaaac tggtggagag cttttagact ctacttggtt attcgatgtg      2220
     tatacggggc agggtgtcga agaaggtaaa cgctcattag cgtttgcgtt attatggcaa      2280
     catccttcac gtacgcttga agatgctgaa attaaatctg gtatggacaa tataatccaa      2340
     gtgttggaaa acacttatca agcgacattg agggcctcat ga                         2382
//

If you have problems or comments...

PBIL Back to PBIL home page