(data stored in ACNUC29543 zone)

EMBL: CP000521.PE588

CP000521.PE588       Location/Qualifiers
FT   CDS_pept        complement(654250..654576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11055"
FT                   /protein_id="ABO11055.1"
FT                   /translation="MSATIVNTTDDNFQADVLDAETPVLVDFWAGWCAPCKAIAPVLED
FT                   LSSEYAGKVKIVKVDVTSCEETAVKYNIRNIPALLLFKNGEVVAQQIGAVPRSKLVSFI
FT                   DENV"
     atgtctgcga ctattgtaaa tacaactgat gataacttcc aagcagatgt tctagatgct        60
     gaaacacctg tacttgttga cttttgggca ggttggtgtg caccttgtaa agcaattgca       120
     cctgttcttg aagatttatc aagtgaatat gcgggtaaag taaaaatcgt taaagttgac       180
     gtgacttctt gtgaagagac ggcagtgaaa tacaatatcc gtaatattcc tgctctatta       240
     cttttcaaaa atggtgaagt agtagctcag caaatcggcg ctgtgcctcg ttctaaactc       300
     gttagcttta ttgacgaaaa cgtttaa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page