(data stored in ACNUC29543 zone)

EMBL: CP000521.PE590

CP000521.PE590       Location/Qualifiers
FT   CDS_pept        656395..657216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0608"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase (alpha subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11057"
FT                   /db_xref="GOA:A3M2B3"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M2B3"
FT                   /protein_id="ABO11057.2"
FT                   /translation="MKKATQSKAWTTVQIARHPERPQFLDYVGEIFTEFDALHGDRLFG
FT                   DDGAMVGGLARFDGQPVMVIGQHRGRSTREKLKHNFGMCNPEGYRKSQRLLDMAERFNL
FT                   PVFTFIDTMGAYPGVGAEERGQAEAIATSLAQLSSLKVPVIATVLGEGGSGGALGIGVA
FT                   DRVIMLSHSIYSVISPEGCASILWKTAEKAAQASEALGLTADKLQSLGIVEYVVDEGEG
FT                   AHLDPERVMQNLKVVLKQALDELLPMDANERCEARYQRLMKFGSENLGMAS"
     atgaaaaaag ctactcagtc caaagcgtgg acaacggttc aaattgcacg tcatcctgaa        60
     cgtccgcagt ttctagatta tgtcggtgaa atctttacag agtttgatgc attgcatggt       120
     gatcgtttgt ttggtgacga tggtgcgatg gtaggtggtc ttgctcgttt tgacggtcaa       180
     cctgtgatgg tcattggaca acaccgtggt cgtagtaccc gtgaaaaatt aaagcacaac       240
     tttggtatgt gtaacccaga aggttaccgt aaatctcagc gtcttttaga tatggctgag       300
     cgtttcaatc tcccagtttt cacctttatt gatactatgg gcgcatatcc gggtgttggt       360
     gctgaagaac gtggtcaggc agaagcaatt gcgactagcc ttgctcaact ttcaagcctg       420
     aaagtgcctg taatcgcaac agtacttggt gaaggcggtt ctggtggtgc tttaggtatt       480
     ggtgttgctg acagagtgat tatgttgtca catagtattt attctgtgat ttcgcctgaa       540
     ggctgtgcat ctattttgtg gaaaactgct gagaaagcag ctcaagcgag tgaagcttta       600
     ggtttaacag cagataaact acaatcacta ggtattgttg aatacgtagt agatgaaggt       660
     gaaggtgcgc atttagatcc tgagcgtgtg atgcaaaact taaaagtagt tttaaagcag       720
     gctttggatg aattgctacc aatggatgca aatgaacgat gcgaagcacg ttatcaacgt       780
     ttaatgaagt ttggcagcga aaatttaggc atggcgtctt aa                          822
//

If you have problems or comments...

PBIL Back to PBIL home page