(data stored in ACNUC29543 zone)

EMBL: CP000521.PE593

CP000521.PE593       Location/Qualifiers
FT   CDS_pept        659386..659955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0611"
FT                   /product="putative integral membrane resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11060"
FT                   /protein_id="ABO11060.2"
FT                   /translation="MGANSALIFGILINVAILLVFFRFLMQLAAVSPYNPVVLSTVKAT
FT                   KIVDIFGRIFPTVAKGRFNLAALVLLIILYLLKIFGVMYLSGSMPNSPVHLVILTFVTM
FT                   IQDLIRFCRYLIFATIILSWVVMFTQSRSPYIEVIQDLAEPLLAPFRRLLPNMGMIDLS
FT                   PILAFLALYIAEILMNEVAKVLLTGL"
     atgggtgcaa attctgcgct aatttttgga attttaatta acgtcgcgat tttattggtc        60
     tttttccgtt ttttaatgca attggcggca gtaagtcctt ataatcctgt ggttttatcg       120
     acagtaaagg cgactaagat tgttgatatt tttggccgaa tttttccaac agtcgcaaaa       180
     ggccgattca atctggcagc gttggttctt ttaattattt tatatttact gaaaattttc       240
     ggtgtaatgt atctttcggg ttccatgcca aatagtccag ttcatttagt gattctgact       300
     tttgtgacca tgattcagga tttgattcgt ttctgccgtt acttaatttt tgcaacaatc       360
     attttgagtt gggtcgttat gtttactcaa tctcgttcac cttatattga ggtgattcaa       420
     gatttagctg aaccgttact cgccccattc cgtcgtttat tacctaatat ggggatgatt       480
     gacttatctc caattctggc atttttggca ctctatattg ccgagatctt aatgaatgaa       540
     gtcgctaaag ttttattaac tggactttaa                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page