(data stored in ACNUC29543 zone)

EMBL: CP000521.PE598

CP000521.PE598       Location/Qualifiers
FT   CDS_pept        667591..669072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0616"
FT                   /product="secretion protein XcpR"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11065"
FT                   /protein_id="ABO11065.2"
FT                   /translation="MKQIQVPYSFAKRHGVLFRYDGDQVFIVRRQNTEKIALQEARRIL
FT                   GKPAHYQLCTEQEFNSLLSTSYAGDTGESQQVAAGLEDHPDLLSLADQVPETEDLMDQE
FT                   DDAPIVRLINALLSEAIRVGASDIHIEAFEKKLSVRLRVDGQLREIVQPRRELAPLLVS
FT                   RIKVMAKLDIAEKRVPQDGRISLRLAGREVDVRVSTLPSSHGERVVMRLLDKQAGRLNM
FT                   THLGLMANDYERLTQLVHRPHGIILVTGPTGSGKTTTLYAALSDLNDNTRNILTAEDPI
FT                   EYQLEGIGQTQVNTKVDMTFARALKAMLRQDPDVVMVGEIRDLETAEIAVQASLTGHLV
FT                   LSTLHTNTAIGAVTRLKDMGIEPFLLSSSLIGVVAQRLVRTLCPHCMTWREADTFEKQV
FT                   FQHISHEPSLKLPEAQGCDQCSHLGFNGRTAIYEIVPIDEPMRRLIHGNAAEFELENHA
FT                   RQYSGSIRDDGLRKVLSGKTTLEEVLRVTNEASEA"
     ttgaaacaaa tacaagttcc atatagtttt gccaagcgtc atggtgtttt atttcgttat        60
     gacggtgatc aagtttttat tgttagacgt caaaatacag aaaaaattgc attgcaggaa       120
     gcaagacgaa ttttggggaa acctgcacac tatcaattat gcactgaaca agaatttaat       180
     agtctattaa gtaccagtta tgcaggtgat acaggtgaat ctcaacaagt agctgcaggc       240
     ttagaagacc atccggattt attaagcctt gcagatcagg tgcctgaaac agaagactta       300
     atggatcaag aggatgacgc gcctattgtt cgtctaatca atgcacttct ctctgaggca       360
     attcgtgttg gagcttcaga tatccatatt gaagcctttg agaaaaagct atcagttcgt       420
     ttacgggtag atggtcaatt acgtgaaatt gtgcagccac gccgtgaact agccccgtta       480
     cttgtttcgc gtattaaagt tatggcgaaa ctcgatattg ctgaaaagcg tgtaccgcaa       540
     gatggacgta tttctttacg tcttgctggt cgtgaagtcg atgtccgtgt ttcaactttg       600
     ccatcgtcac atggtgaaag ggtggtcatg cgtttactcg ataaacaagc gggtcgcctt       660
     aatatgactc acctaggttt aatggcaaat gactatgaac gtttaactca gttagtacat       720
     cgtccgcacg gtattatttt ggtcacaggg cctactggtt cggggaaaac gacgacttta       780
     tatgctgcct tatctgatct aaatgacaat acccgtaaca tcttaaccgc cgaagatcca       840
     attgagtatc agcttgaagg tattggccaa actcaagtga ataccaaagt ggatatgaca       900
     tttgctcgtg ctttaaaggc aatgttacgt caagatccag atgtggtcat ggtgggggag       960
     attcgtgatc tggaaactgc tgaaattgcg gtgcaggcat ccttaacagg tcatttggtt      1020
     ttatcgacgc tacataccaa caccgctatt ggtgcagtga ctcgacttaa agatatgggg      1080
     attgaacctt tcctgctttc aagttcttta attggggtgg ttgcgcagcg tttggttcgt      1140
     actttatgtc cacattgtat gacatggcgt gaagccgata cttttgagaa gcaagttttt      1200
     cagcatattt ctcatgaacc aagtttaaag ttaccagagg ctcaagggtg tgatcagtgt      1260
     tctcatttag ggtttaatgg ccgtacagcg atttatgaaa ttgtacctat tgatgaacct      1320
     atgcgccgtc tcattcatgg taatgcagct gaatttgaat tagaaaacca tgctcgtcag      1380
     tattctggtt ctattcgcga tgatggttta cgtaaggtgc tctcaggtaa aactacactt      1440
     gaagaagtgc ttcgtgtaac caatgaagca agtgaagcat aa                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page