(data stored in ACNUC29543 zone)

EMBL: CP000521.PE599

CP000521.PE599       Location/Qualifiers
FT   CDS_pept        complement(669127..669558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11066"
FT                   /protein_id="ABO11066.2"
FT                   /translation="MSLEKVVYRAKAKATGGRDGRATSSDGVLDVQLGVPKEMGGAGGA
FT                   VTNPEQLFAAGYSACFLGALKFVANRDKFNISKDAYVEGEVGIGPIPTGFSIEVTLNVY
FT                   LIGMDREEAEKLVAAAHIVCPYSNATRNNIDVTFNIVTE"
     atgtcattag aaaaagttgt gtatcgtgca aaagccaaag caacaggtgg ccgtgatggt        60
     cgtgcaactt catcagacgg tgtattagac gtacaacttg gtgtacctaa agaaatgggc       120
     ggcgctggtg gtgctgtaac taacccagaa caattatttg cagctggtta ttcagcatgc       180
     tttttaggtg ctttaaaatt tgttgcaaat cgcgataaat tcaatattag caaagatgcg       240
     tatgttgaag gtgaagtcgg tattggtcca attccaacag gttttagtat tgaagttact       300
     ttaaatgttt atttaatcgg tatggaccgt gaagaagctg aaaagttagt tgcagcagct       360
     catatcgttt gtccatattc aaatgcaact cgtaacaata ttgatgtgac gtttaatatt       420
     gtgactgaat aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page