(data stored in ACNUC29543 zone)

EMBL: CP000521.PE600

CP000521.PE600       Location/Qualifiers
FT   CDS_pept        complement(669646..670083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11067"
FT                   /protein_id="ABO11067.2"
FT                   /translation="MDQDCQNLKLENQLCFLIYSTNLALNQLYRKLLTPLGITYPQYLV
FT                   MLVLWEKDEITVSEIGSKLFLESSTLTPILKKLEALQLLNRTRSKEDERQVIITLSEKG
FT                   KKLKEQAVNIPTHILEASSCDTATLLGLKDQLTQLRTNIAK"
     atggaccaag actgtcaaaa tctaaagctt gagaatcaat tatgtttcct catttattca        60
     acaaatttag cccttaatca actttatcgc aaacttttaa ctccattagg gattacttat       120
     cctcaatatt tggtgatgtt ggtgttgtgg gaaaaagatg agattactgt ttcagaaatt       180
     ggcagtaagt tatttttaga atcttcaact ttaactccaa ttttaaaaaa gttagaagca       240
     ttgcagcttc ttaatcgtac tcgttcaaaa gaagatgaaa gacaagtcat tatcacgctt       300
     agcgaaaagg ggaaaaaact taaagaacag gccgtaaata ttccaacgca tatcttagag       360
     gccagttctt gtgatacggc tacccttctc ggtctcaaag atcaattaac acaactccgt       420
     acaaatatag ctaaataa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page