(data stored in ACNUC29543 zone)

EMBL: CP000521.PE601

CP000521.PE601       Location/Qualifiers
FT   CDS_pept        complement(670243..670620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3507"
FT                   /old_locus_tag="AS1_3507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3507"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89932"
FT                   /protein_id="ABS89932.2"
FT                   /translation="MWKYLFSIFCLGANIHCYATDFGTTNNFVSPNLQLKQNVLPPTPK
FT                   NIPLPAFGQRIIGWGTGAEGARQRLENIQPADVSMIKKQGTTLEMITAWQDFYEQEQQR
FT                   NENNPTAKYRARLMKKIADLW"
     atgtggaaat acttatttag cattttttgc ttaggggcaa atattcactg ttatgcgact        60
     gatttcggga caacgaataa ttttgtctct ccaaatttgc agcttaaaca aaatgtacta       120
     cctcctactc caaaaaatat tcctctgcct gcttttggcc agcggattat tggttggggg       180
     acaggtgcag aaggtgccag acagcgttta gagaatattc agcctgccga tgtttctatg       240
     attaaaaaac aaggaacaac tttagaaatg atcacggcct ggcaagattt ttatgaacaa       300
     gagcaacaac gtaatgaaaa taacccaact gcaaaatatc gtgctcgttt aatgaaaaaa       360
     attgccgacc tttggtaa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page