(data stored in ACNUC29543 zone)

EMBL: CP000521.PE606

CP000521.PE606       Location/Qualifiers
FT   CDS_pept        complement(674836..676950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0623"
FT                   /product="DNA mismatch repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11072"
FT                   /protein_id="ABO11072.2"
FT                   /translation="MTSTTKKFKLHPKFIVNAIEQQANGLPKAIVELIMNSIDANATQI
FT                   NIKLWLNAKKHLQFEIIDDGKGFTKKSIDEYFAMFGAPHEEGDATYGKFRIGRGQVFNY
FT                   AITTWTSNNYQLKVDIYKPLREKSDEELGFTITRLAKKFNGCKISGYIYTNITDSMGSI
FT                   TEIIEEIQSIIKYVQIPVFINKNQINKNISDCLDSECKIIEDDYAYYILDPNSDSLKVY
FT                   NIGVWVPYARFKNAIFKGSIISKSQFKITSSRNEIIEDRCELFKNIEGKIRDVVDPTFI
FT                   KLTTINEKKNKKLSSKLALGMLANILKNPLKDCRYDKEAILMMLNTPLDVFTDYKGYKQ
FT                   SLIDISKSKAIMMLIRSDYDVLVVEKIEKRTNCLILEETYDISHLQGYLRTRLIQEYID
FT                   KNEQPDNENLYDYDYMLMKLLSEFKDIVVAYTNYEMFTDIPPVTLLNYKDEKEKVCFDR
FT                   KIIDQKDLNNEQTGFLEFLKKLNTSFCDAYPDFINDCYGKREIFLGKSELDNAWTNMTS
FT                   NIVFDIRTISFYQQNSYLRLLLILIHEYAHLLDDEEGHNFEFYERFHDFVIRNDFIPLL
FT                   ESLSSSNNSIHSNSSSTAPDETELKLLAMIDQPTPQNARELYNILHDLNYSFKAVEEGK
FT                   KNKELFGLSYDTFNAWLADPKSTRYRNPKLQTWQSFIYETIAKKRGFNDFNAMVLSNVF
FT                   NCGTTTKEKV"
     atgacctcta caacaaaaaa atttaagctg catcccaaat tcatcgtgaa tgccattgag        60
     cagcaagcca acggtttacc taaagcgata gtagagttga taatgaactc tattgatgca       120
     aatgccacgc aaataaatat aaaattatgg ttaaatgcca aaaaacatct tcagtttgaa       180
     attattgatg atggaaaagg ttttaccaaa aaatctattg atgaatactt tgcaatgttt       240
     ggtgcacctc atgaagaggg tgatgctaca tacggaaaat ttcgtattgg tcgcggacag       300
     gtctttaatt acgctataac cacatggaca agtaataact accaactcaa agtagatatc       360
     tataagccgc taagagaaaa gtcagacgaa gaacttgggt ttactattac tagactcgcc       420
     aaaaagttca atggatgcaa aatatccggt tatatttata caaacattac agattcgatg       480
     ggttctatta ctgaaataat agaagaaatc caatcaatta ttaaatatgt tcaaattcca       540
     gtattcataa ataaaaatca aattaataaa aatatatcag attgtttaga ttctgaatgc       600
     aaaatcattg aagatgatta tgcatattat attctagatc cgaattctga ttcccttaaa       660
     gtctataata taggtgtttg ggttccttat gcccgtttta aaaatgctat ttttaaaggt       720
     agtattattt ctaaatctca attcaagatt acatcttcac gtaatgaaat tattgaggat       780
     cgttgtgagc tatttaaaaa catagaaggg aagatccgag atgtcgtaga tccaaccttt       840
     ataaaactca ccacaatcaa tgagaaaaaa aataagaagc tatcgagcaa attagcttta       900
     ggtatgctag ctaatattct aaaaaatcca ctgaaagatt gccggtatga taaagaggca       960
     atattgatga tgctcaatac acctctcgat gtctttaccg actataaagg ttataaacaa      1020
     agccttatcg atatttcaaa atctaaagct atcatgatgc taattaggtc agattacgac      1080
     gtgctcgtag ttgaaaaaat cgaaaagaga acaaactgtc tcatcttgga ggaaacctat      1140
     gatatttcgc atttgcaagg ctatctccgc acacgcctaa ttcaagagta tatcgataag      1200
     aatgaacagc cggataatga aaacttatat gattatgatt atatgcttat gaagctgtta      1260
     tctgagttta aagatatagt tgtagcctat accaactatg aaatgttcac agacatacct      1320
     ccagtaaccc ttttaaatta taaggatgaa aaggaaaagg tatgttttga tcggaaaata      1380
     attgaccaaa aagatctaaa taacgagcaa accggctttc ttgaatttct aaaaaaattg      1440
     aatactagtt tttgtgatgc ctatccagat tttataaatg attgttatgg taagcgagag      1500
     atttttctag gcaaatcaga gctagataat gcatggacca acatgacatc gaatattgtc      1560
     ttcgatataa ggacaatcag cttttaccag cagaattcat atttaagatt actattaatt      1620
     ttaatccatg agtatgcaca tcttctcgac gatgaagaag gccataattt tgaattctat      1680
     gaacgattcc atgattttgt tattcgcaat gactttattc cacttctgga gagcctaagt      1740
     tcatctaata actccataca tagtaattcg agctcaaccg ctccggatga aactgaatta      1800
     aaacttttag caatgatcga tcaaccaacg cctcaaaatg cgcgagaact ctataacata      1860
     ctgcatgact taaattattc attcaaagca gttgaggaag ggaaaaagaa taaagagtta      1920
     ttcggattaa gctatgacac ctttaatgct tggctggctg atcctaagtc tacacgctac      1980
     agaaatccaa agctgcaaac ttggcaaagt ttcatttatg aaactatagc aaagaaaaga      2040
     ggctttaatg atttcaatgc aatggtactc agtaatgtct tcaattgtgg aacaactact      2100
     aaagagaagg tttga                                                       2115
//

If you have problems or comments...

PBIL Back to PBIL home page