(data stored in ACNUC29543 zone)

EMBL: CP000521.PE610

CP000521.PE610       Location/Qualifiers
FT   CDS_pept        680323..680808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3508"
FT                   /old_locus_tag="AS1_3508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3508"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89933"
FT                   /protein_id="ABS89933.2"
FT                   /translation="MATPQSCNKFALKASCKDCPFRKDSGGYLHPERVREIVNYMSKDD
FT                   ALFPCHKTVGTARTNLNEALELLEDELAFTGLSQNLTARKELEEKYQIDNLQEALLKDM
FT                   KSEKVCAGWLILGKKEQIINNNFPLRLAQMQGLLQLNDLTREDEIYDSIEQAIEDHS"
     atggctaccc cccaatcttg caataaattt gccctaaaag cctcctgtaa ggattgtccg        60
     tttagaaaag atagcggagg ttatctacat ccggaaaggg tacgggaaat agttaattac       120
     atgagtaaag atgatgctct tttcccttgt cataaaactg tgggtacagc tcggactaat       180
     ttaaacgaag ctttagagtt gctagaagat gaactggcgt ttaccggact ctcacaaaat       240
     cttacggcac gaaaagaact tgaagagaag taccagattg acaatcttca ggaagcacta       300
     cttaaagata tgaagtcaga aaaggtttgt gctggctggt taatattagg gaaaaaagag       360
     caaatcatta acaataattt cccattgaga ttagctcaaa tgcaaggact cttacagcta       420
     aatgacttaa caagggagga tgagatatat gattctattg agcaagcaat tgaagatcat       480
     tcttga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page