(data stored in ACNUC29543 zone)

EMBL: CP000521.PE611

CP000521.PE611       Location/Qualifiers
FT   CDS_pept        681320..681889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3509"
FT                   /old_locus_tag="AS1_3509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3509"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89934"
FT                   /protein_id="ABS89934.2"
FT                   /translation="MTNKASQPRTFTLSDEKRNHILTTALNLFDQFGFQHISIMRIITE
FT                   AKIAKQSFYMAFPSKDSFIIECLDMEINRLKQSLSNLLGQCGKDDHTSILKSFYQWHVD
FT                   LAYREGYNGTLLTKAVIEYWNLPDIKMKVEDFNKWKYEIFAEYLAEEINNARLRIIVSA
FT                   MNGILLPASTYLPTWEDIESLYGEQF"
     atgacaaata aagcttcaca gcctagaaca tttacattat ctgatgagaa gaggaaccat        60
     atcttaacga cagctctaaa cttatttgat cagtttggtt ttcagcatat aagcattatg       120
     cgtattatca ctgaagcaaa aattgctaaa caaagtttct acatggcttt cccttccaaa       180
     gattctttca tcattgaatg tttagatatg gaaatcaata gactgaagca atcactaagc       240
     aacctcttgg gccagtgtgg taaagatgac catacaagta ttttaaaatc cttctatcag       300
     tggcacgtgg acctagctta tagagaagga tataacggta cgctgttaac aaaagctgtg       360
     atcgaatatt ggaatttacc agatataaaa atgaaggttg aagacttcaa caaatggaaa       420
     tatgaaattt ttgcagagta tctggcggaa gaaatcaaca atgctcgact aagaattata       480
     gtaagcgcaa tgaatgggat tttattgccg gctagtactt acttgcctac atgggaagat       540
     attgaaagtt tatatggtga gcaattttga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page