(data stored in ACNUC29543 zone)

EMBL: CP000521.PE614

CP000521.PE614       Location/Qualifiers
FT   CDS_pept        complement(683475..684857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11076"
FT                   /protein_id="ABO11076.2"
FT                   /translation="MNQNNTEAEVNLFRFTFHFITQNTNSFFVSVEGPDENETLINFVN
FT                   DMYRVLYASNVKQDLDPAHPNQIKASALQRMTPSLRTQVNAMLSDYTKLKPSIHKAISK
FT                   LNSIEDDEYFFVFPYEFTEKMQAQMLLQTFLRAKNSLNSDEEVNQYMQTHMEGFNSLFD
FT                   DLLEQYNIAVFGETERKTVIGQKPTKEHGVCRFCKSPVDENTTFRKVAHTISEALGNKS
FT                   IVTADECDTCNEKFGRDFEPHLIQYLDILRVYYGTRGKKGIPHLKFKNGQVYQHKLEGS
FT                   EEHSIVIASQDIVETENGLIVSLLAHQKVNKLKIFKSLCKYAISVLPAEELPAFESTIN
FT                   WLFLDPELGEEEQQFHIAKMYGQSYTEHPELTLYTRISDTDPEWPHVVAEFKLGTLHLI
FT                   FILPFSKKDSSIFNLETDFPKLCQLFRHYQKFEDQIIFENLSNSEDRECDYKVRFSTDK
FT                   IN"
     atgaaccaaa acaatactga agctgaagta aatctatttc gatttacttt ccactttatt        60
     actcaaaata cgaatagttt ttttgttagc gtagaagggc cagatgagaa tgaaactctt       120
     ataaacttcg tcaatgatat gtacagagtt ttatacgcca gcaatgtcaa acaggatctc       180
     gatccagcac atcccaatca aatcaaagcc agcgctttac aacgcatgac accaagttta       240
     cggacacaag ttaatgctat gttaagcgat tacactaaac tcaagcctag tattcataaa       300
     gcgattagta agctcaattc gattgaagat gatgaatact tctttgtatt tccctatgag       360
     tttacagaaa agatgcaagc acaaatgctt ttgcaaactt ttcttagagc caaaaattca       420
     ttgaatagcg atgaagaagt aaatcaatac atgcaaactc atatggaggg gtttaatagc       480
     ttatttgatg atttattaga gcaatacaac atagctgtgt ttggtgaaac agaacgtaaa       540
     actgttatag gccaaaaacc aacaaaagaa cacggcgttt gtaggttttg taaatcaccg       600
     gttgatgaaa acacaacctt ccgaaaagtg gctcatacga tctctgaagc gctgggcaat       660
     aaatcaatcg tgacggcaga tgaatgcgat acatgtaatg agaagtttgg ccgtgatttt       720
     gaacctcatc tcatacagta ccttgatatc ctacgtgtat attatggaac aagaggaaag       780
     aagggcattc cccatctgaa gtttaagaat ggccaagtgt accagcacaa gctagaagga       840
     tctgaagaac actcgattgt gattgcttcg caggatattg ttgaaacaga aaacggttta       900
     attgtcagcc tgttagccca tcaaaaagtt aacaaactaa aaatctttaa gtcattatgc       960
     aaatacgcta tctcagtatt gccggccgaa gaactaccgg catttgaatc gacaattaat      1020
     tggttgttcc tagatccgga acttggtgaa gaagaacagc aattccatat agccaaaatg      1080
     tatggccaaa gttatacgga acatccggag ttaacactat atacacgaat cagtgatacg      1140
     gatccggagt ggccgcacgt ggtagcagaa ttcaagttag gtacgttgca tttaatcttc      1200
     attcttcctt tttctaaaaa agattcttcc atattcaact tagaaacaga cttcccaaaa      1260
     ttgtgtcagc tcttcaggca ttaccaaaaa tttgaagatc aaatcatttt tgaaaattta      1320
     tcgaactctg aagatagaga atgtgattat aaagtaaggt ttagcacaga taaaattaat      1380
     taa                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page