(data stored in ACNUC29543 zone)

EMBL: CP000521.PE618

CP000521.PE618       Location/Qualifiers
FT   CDS_pept        complement(687879..688160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3514"
FT                   /old_locus_tag="AS1_3514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3514"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89939"
FT                   /protein_id="ABS89939.2"
FT                   /translation="MKEFNLDGYSSIELENLIKAASLEKGKREIEEKVAAFGQLEEIAK
FT                   SVGLTLDQLIEFGKTHNKKKKQRLLSHVIEVRLIRRTLGQDEDRCQDG"
     atgaaagaat ttaatttaga tggttattca tcaatagaac tagagaattt gatcaaggct        60
     gcaagtcttg aaaaaggaaa aagggaaatt gaagagaaag tggcagcctt tggccaatta       120
     gaggaaattg ccaaaagtgt tggactgact ttagaccagc tcattgaatt tgggaaaacc       180
     cataataaaa agaaaaaaca aagactgttg agccacgtta tagaagtaag gctgatccgg       240
     agaacacttg gacaggacga ggacagatgc caagatggtt ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page