(data stored in ACNUC29543 zone)

EMBL: CP000521.PE619

CP000521.PE619       Location/Qualifiers
FT   CDS_pept        complement(688205..689929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3515"
FT                   /old_locus_tag="AS1_3515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3515"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89940"
FT                   /protein_id="ABS89940.2"
FT                   /translation="MNVQSQELTSSDAESLSPADLGYSQANSLSQGHPNLASFKYETEF
FT                   KLPVSLIHVTHECSLVEHKIWLCLLNHACEILENFQDNGSHPIVNFKIPFDLLRFKTNS
FT                   QHRLKEINKSLSNLRDAEIQIDIFNAQGLKSSSSQFSFIQDFAIYNKNMMLNREEVEAD
FT                   NKPDYQSLEIVYSLPPFFSSIITDSISIEKVKRLFSWTQIQSLSTSTGRNGKIELLIYK
FT                   LLEGTDEPITLAYETFKQYLGYGDVEENRYFLRDTLKPALKNFNANELLEYEVETDFIR
FT                   GKRQKIESIKLFKKYKFVDNEQAAHAWQSLLDSPPENTTNLRIRIKQLVPENYDIDSLT
FT                   DDSIYTILSRLKQWINGLKKKGQTINFVGACRSAFKDKSWIDSKNGKGQSSLILGEEVD
FT                   DVVVKASRTNYESAVGKGDIPKTSQESDYNNPVNKIAKSVATLISTLAIKGSKTTFFEN
FT                   ISKENFDELTNNNLKYFNYFSENIDSFKNDYVIDMVKRIFFVGNENALNSLLNQSNQSK
FT                   VLYPYLFSVNFAMQNYTQIISDPIRSGAYSTNLANNELAVNIVVGDLIKYFKSQLSI"
     atgaacgtac aatcacaaga attgactagt tctgacgcag agagcttgtc tcctgctgat        60
     ctgggctata gtcaagctaa tagtcttagt caagggcacc caaatttagc ctcttttaag       120
     tatgagacag agtttaaact gccagtttca ttaattcatg tgactcatga atgttcatta       180
     gttgaacata agatttggtt gtgtctcttg aatcatgctt gtgaaattct tgaaaatttt       240
     caagataatg gttctcatcc tattgttaat tttaaaatac cgtttgatct attaagattc       300
     aaaacaaata gtcaacacag acttaaggag attaataaat cactaagtaa tttaagagat       360
     gctgaaatac aaatcgatat cttcaatgca caaggattaa agtcatcttc ctcacaattc       420
     agctttattc aagattttgc gatttataat aaaaatatga tgcttaatcg agaagaggtg       480
     gaagctgata acaaaccaga ctaccaaagt cttgaaattg tatattcatt acctcctttt       540
     tttagttcaa ttattactga ttctatttcg attgaaaaag taaaacgttt atttagttgg       600
     acacaaatac aatctttaag tacatcaaca ggaagaaatg gaaaaattga attattaatt       660
     tataaattac tggaaggaac tgatgagcca attactttgg catacgaaac attcaaacag       720
     tatctaggct atggtgatgt agaagaaaat cgttatttct tgcgtgatac tcttaaacca       780
     gctttaaaaa attttaatgc aaacgaattg cttgaatatg aagttgaaac agactttata       840
     agaggtaagc gtcaaaaaat agagtcgata aaactattca aaaaatataa gtttgttgat       900
     aatgaacaag ctgctcatgc atggcaatca ctcttagata gtccacctga gaatacaaca       960
     aatttacgaa tccgtattaa gcagttagtg ccggaaaatt atgatatcga tagtttaaca      1020
     gatgattcta tatatacgat tctatcgcgt cttaaacaat ggataaatgg attgaagaaa      1080
     aagggccaga caattaactt tgtcggggca tgccgttcag catttaaaga taagagctgg      1140
     attgattcta aaaatggtaa agggcaatca tcattaattt taggcgaaga agtcgatgat      1200
     gttgttgtga aggctagtag aacaaactac gaaagtgccg tgggtaaagg cgatattccc      1260
     aaaacttcac aagagtctga ttacaataat ccagtgaata aaattgctaa atctgttgcg      1320
     actttgattt ctactttagc tatcaaagga tctaaaacaa cgttctttga aaatatatct      1380
     aaagagaatt ttgacgaatt gaccaataat aatttgaagt actttaatta tttttccgaa      1440
     aatattgatt cattcaaaaa tgattatgtt attgacatgg tcaagcgaat attctttgtt      1500
     ggaaatgaaa atgcattaaa ttctttactg aatcaaagta atcagagtaa agtactctat      1560
     ccttatttat ttagtgtaaa tttcgcgatg caaaactata ctcagattat tagtgaccct      1620
     atccgatctg gagcctatag tacaaactta gcaaataacg aacttgcggt taatattgta      1680
     gttggagatt taattaaata ttttaaatct caattatcaa tttaa                      1725
//

If you have problems or comments...

PBIL Back to PBIL home page