(data stored in ACNUC29543 zone)

EMBL: CP000521.PE621

CP000521.PE621       Location/Qualifiers
FT   CDS_pept        complement(690099..690749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3517"
FT                   /old_locus_tag="AS1_3517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3517"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89942"
FT                   /protein_id="ABS89942.2"
FT                   /translation="MTNLASMPYAHSLYLNEPAEWKKQSSVQLSLLDDVQEPSVVERSL
FT                   PALPLKRFSKLFSFLDFDFDTKSYEYMVGSDRFTIETKIDKADQAFVCLINEVLMAYKQ
FT                   KNILLTSFDSKLTHTINASEISKVVGISLDEFEKRMKSLASCSLSAHQHRLLRHTKTGR
FT                   ESFRFVICFQPNSLVNTFLLIKMGRFSTALIMHLSLKRCLKKTYIRKINHNLI"
     atgactaatt tagcatctat gccctatgct cactcattat atttgaatga gccggcagaa        60
     tggaaaaaac agtcatctgt tcaattatca ttattggatg atgtacaaga gccttctgta       120
     gttgaacgtt ctttacctgc tttaccatta aaaagatttt ctaaattgtt ttcattttta       180
     gatttcgatt ttgatactaa gtcatatgaa tatatggtcg gatcagatcg atttactatt       240
     gaaactaaaa ttgataaagc cgatcaagct tttgtgtgtt taattaatga agttttaatg       300
     gcttataagc aaaaaaatat tttgcttact tcatttgata gcaaactgac tcatactatc       360
     aatgcaagtg aaatttccaa agttgttggt atttcattag atgagtttga aaaaagaatg       420
     aaaagcttag caagctgttc tttgagtgct catcaacacc gcttacttcg tcatacaaag       480
     accggccgcg aatcttttag atttgtcata tgttttcaac caaactcgtt agtgaatacg       540
     tttcttttga taaagatggg cagattttct acagctttaa ttatgcacct ttctttgaaa       600
     cgatgtttaa agaaaaccta cataagaaaa atcaatcaca accttattta g                651
//

If you have problems or comments...

PBIL Back to PBIL home page