(data stored in ACNUC29543 zone)

EMBL: CP000521.PE622

CP000521.PE622       Location/Qualifiers
FT   CDS_pept        691527..692903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3518"
FT                   /old_locus_tag="AS1_3518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3518"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89943"
FT                   /protein_id="ABS89943.2"
FT                   /translation="MIKNNDLDNLRNLNRNIIQNKPNSAPATPQRLFVYLDGIAQNNDG
FT                   HDYAYGTNVLTNEKVKVRLTTIDERIDDLVDSGRAKNRQQVASQVTNQYQNSANPRQSL
FT                   KARLNSNVVVLSFDQSFEIKSEDNYRSYRSHWAESVTSNPSSQLITAPVHIQFVNNQRP
FT                   FGRVEILEENFKIDIGSSKENIKDAFLKSLVHQDEFSAERSGSLNYILRYKDTNEPIYQ
FT                   GSLQTFLQQVSVGPDRSIRIPADINTTLNNLMRKPLTTQDFTPDDSMMFNHDLNRILVN
FT                   RFLGVEFSQKLETSNPQLQDNLRLISGKLKKGEIYLDAYSTQNIFFGRDTLKTYQAKAN
FT                   RNSSPLKIYTVTDMHNEQPVYQKGYIHSLVGIDRHSDTLAPFVTFSSTTDPMAVSKKIQ
FT                   DLNINEENLKRTIYLKEEFQKHPLPNSAAPVVDKERANINRIREEMQNQSNNSINFNNI
FT                   "
     atgattaaaa acaatgactt ggataatcta agaaatttga atagaaatat tattcaaaat        60
     aaacctaatt ctgctccagc tactcctcaa aggcttttcg tttatcttga tggtatcgca       120
     caaaacaacg atggccatga ttatgcttat ggaacaaacg tcctaaccaa tgaaaaagtg       180
     aaagttagac taacaacaat tgatgaaaga attgatgact tagttgactc tggtagagca       240
     aagaacagac aacaagttgc ctctcaagta acaaatcagt atcaaaactc tgccaatcct       300
     cgtcaatctt taaaagcgcg actgaacagc aatgtagttg tacttagttt tgatcaatct       360
     tttgaaataa agagtgaaga taattaccgg tcatatcgta gccattgggc agaatcagta       420
     acaagcaatc ctagttcaca actaattaca gctcccgttc atatccaatt tgtaaataat       480
     caaagacctt tcggacgtgt cgaaatttta gaagagaatt tcaaaataga tataggatcc       540
     tcaaaggaaa atataaaaga tgcattttta aaatctcttg tacatcaaga tgagttcagc       600
     gctgaaagat ccggatcttt aaattatata ctgcgttata aagatactaa tgaaccaatc       660
     tatcaaggtt ctttgcaaac ttttttacaa caagtatctg taggtcctga ccgatctatc       720
     cggataccag cggatattaa tactactctc aataatttaa tgaggaagcc tttaaccacg       780
     caggatttca cacctgacga tagtatgatg tttaatcatg atttaaatcg aatattggta       840
     aatagatttc ttggtgttga attttctcaa aaattagaaa cttctaatcc acaattacaa       900
     gataacctac gtcttatttc tggaaagttg aaaaagggtg aaatttatct tgatgcttat       960
     tcaactcaaa atatcttttt tggtagagat acacttaaga catatcaagc aaaagcaaat      1020
     agaaatagca gtccattaaa aatctatact gttactgata tgcacaatga acaaccagtt      1080
     tatcaaaaag gttatataca ttctttagtt ggcattgata gacattcaga cactttagct      1140
     ccttttgtca catttagttc tactactgat ccaatggcag tatcaaagaa aattcaagat      1200
     ttaaatatta atgaggaaaa tttaaagcga accatttatc taaaagaaga attccaaaag      1260
     catccattac ctaatagtgc tgctccagtt gtggataaag aaagagcaaa tatcaataga      1320
     attcgggaag aaatgcaaaa tcaatctaat aactcaataa attttaataa tatttaa         1377
//

If you have problems or comments...

PBIL Back to PBIL home page