(data stored in ACNUC29543 zone)

EMBL: CP000521.PE627

CP000521.PE627       Location/Qualifiers
FT   CDS_pept        702027..703073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3522"
FT                   /old_locus_tag="AS1_3522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3522"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89947"
FT                   /protein_id="ABS89947.2"
FT                   /translation="MHKRTSALNKNPQKLNSVEKKHSFKPKLGFTTGIVLGVSSAIALS
FT                   TTASVGDGLSTIQSSLNQTSNTSTNITNSYTNTTTSTIPTLSASPFAASSNATAAQSAI
FT                   EASSVGCGDASQQGSIAWTQQEVIKNRQILNTAPVDIDALFNGSKGSSSGSCFSDITKI
FT                   IDLSVAIPDWGGMRAAAIAALRQYAQRKVCTMVNEATKKALEPLNNAIDIINKNGTIDL
FT                   NGAVQGAITGGLGKLDPDLANIYQTQAPQGETVNIFDSNQTTFNTDVAKVQDQVNGAIN
FT                   QIGTIGTNTGSTGSTNPTGTSGTTWSNNTSTQSIPNLSANTSNQTQQKAQPQEASRSSI
FT                   FDALFGGS"
     atgcataaac gtacatcagc tttaaataaa aatccgcaga aattaaactc tgtagaaaag        60
     aaacattcgt ttaaaccaaa attaggtttt acaacgggta ttgttcttgg tgtgtcctca       120
     gcaattgcat tgtcgaccac tgcaagtgtc ggagatggtt tatcaactat tcaatcctca       180
     ttgaaccaaa cttctaatac ctctacaaac attacgaata gttatacgaa tacaacaact       240
     tctactattc cgaccttatc agcttctcca tttgctgcta gtagtaatgc tactgctgcc       300
     caatctgcaa ttgaagcttc tagcgtgggt tgtggtgatg cttcacaaca aggttcaatt       360
     gcttggactc aacaagaagt aattaaaaat cgtcagattt taaatacggc accagttgac       420
     atcgatgcat tgttcaacgg atctaagggt tcttcttctg gaagctgttt ttcagatatc       480
     acgaagatta ttgacttgag tgtagcaatt cccgattggg gtggtatgcg agctgctgct       540
     attgctgctt tacgtcaata tgctcaacgt aaagtatgta ctatggttaa tgaagcaacc       600
     aaaaaagcgt tggagccact caataatgct attgatatta ttaataagaa tggaaccatt       660
     gatttgaatg gagctgtaca aggggctata actggtggtt tgggtaagtt agatccagat       720
     ttagcaaata tatatcaaac acaagcacct caaggcgaaa ctgttaacat ttttgattct       780
     aatcagacta cttttaatac tgatgttgct aaagttcaag atcaagttaa tggtgctatt       840
     aatcaaattg gcacaatcgg aacgaatacc ggtagtactg gttcaacgaa tcctactgga       900
     acttcgggta ctacatggtc taataataca tctacgcaat ctataccaaa tttgagcgca       960
     aacacttcta atcaaacaca acagaaggct caaccacaag aagcttctcg ttcttcaatt      1020
     tttgatgcgc tttttggcgg tagttga                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page