(data stored in ACNUC29543 zone)

EMBL: CP000521.PE63

CP000521.PE63        Location/Qualifiers
FT   CDS_pept        69615..70655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3483"
FT                   /old_locus_tag="AS1_3483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3483"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89908"
FT                   /protein_id="ABS89908.2"
FT                   /translation="MSLKIRKELLIFLILSSFLSLLVGFRGNTNDTITYYMIFKNIGSY
FT                   DLTNFSLFYNETGVEIGWGLYSKIISLFSDSPVVLFTIFSFFTFFTFYRISRLVEIKFL
FT                   YVMLYYLPTGFFMMQQFMQIRQGFAIPLVIYGSVLYLSGKKYISLVFFILAILFHQSSL
FT                   AFILIFISYLFFNNFLKINTSVFKFFIINILILVFGFIVARFILLDAAMDYFQRLEAYS
FT                   TTDYAESVGFFSLSNIKFYIEFFLIFLLLNNRLLLNKFIVFFVFIFTVGLSLRVAFYDF
FT                   GILSGRLSNTFLLIEVFLMPMLLSSRLNKIYLYIYFLLYFLVIFYVTWTFQASEFIKNN
FT                   YFLPLS"
     gtgagtttaa aaataagaaa agagttgctc atttttttaa ttctttcctc atttttatca        60
     ttacttgtag gatttagggg gaatactaat gatacaatta catattatat gatttttaag       120
     aatataggat cctatgatct tacaaatttt tctctttttt ataatgaaac aggagtagag       180
     attggttggg ggttatatag taaaattatt tccttgtttt cagattctcc tgtagttctt       240
     tttaccattt tttctttttt tacttttttt actttttata gaatatctag attagtagaa       300
     atcaaatttc tatatgtaat gttgtattat ttgcccactg gtttctttat gatgcaacag       360
     tttatgcaaa ttaggcaagg ttttgctatt ccattggtta tttacggtag tgttttatat       420
     ttatctggta aaaaatatat ttcattggtt ttttttattt tggctatatt gtttcatcaa       480
     agttctttag catttattct tatttttatt tcttatcttt tctttaataa ttttttaaaa       540
     ataaatactt cagtttttaa attttttata attaatattt tgattttagt tttcggattt       600
     attgtggcaa gatttatact tttagacgct gctatggatt attttcaaag attagaggcc       660
     tattctacta ctgattatgc tgaaagtgtt ggcttttttt cactttcgaa tataaaattt       720
     tatatagaat tctttttaat ttttttatta ttgaataata ggttgttatt aaataaattt       780
     atagtttttt ttgtatttat ttttacagtt ggtttgtcat tacgcgtggc tttttatgat       840
     tttggtatat taagtggtag actatcaaat acatttttac taattgaagt ttttctaatg       900
     cctatgttac taagtagtag attaaataaa atttatttgt atatatattt tttattatac       960
     tttttagtga ttttttatgt tacatggaca ttccaagctt cagagtttat aaaaaataac      1020
     tatttcctac cattgagtta a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page