(data stored in ACNUC29543 zone)

EMBL: CP000521.PE630

CP000521.PE630       Location/Qualifiers
FT   CDS_pept        704973..706106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11080"
FT                   /protein_id="ABO11080.2"
FT                   /translation="MKKKTTFLLLSVFSTSVIAAYCPPFSNPLILRDFISGFQQLNATF
FT                   TTGLNTLDQSVSAALTTERQLLLNAIALKTTQEAMNASSIAHADQEIAKATANAIGAVK
FT                   QSERLKETAIDFGAAGQGYNPCKVLNERRTITETQERDKENRPDLIFKEISAGTGKYAN
FT                   PVVAQEQTLKLHHDYFCTSEQVSAGLCMSVGEMSGANLQASTLFEYSSANDKYAIAKTS
FT                   FINNMVGLPDAPLSANAAKTPRGKEYMRQKVENDAVISPAINSLMAIKSEFTENPNGGE
FT                   FGQPVKPLRQQYREQVDRYLGHGEEYKNWNRTLVAAPERGVLVEILKEGALELAIMGNK
FT                   HAQNERIEANLASLVALENKKANSLNKSNIAGSAKAK"
     atgaaaaaga aaacgacgtt tttactatta tcagttttta gtacttcagt aattgctgct        60
     tactgtcctc ctttttcaaa tccattgata ctcagagatt ttataagcgg ttttcagcaa       120
     ttaaatgcga cattcacgac tggacttaat actttggatc aaagtgttag tgcagcttta       180
     actacagaac gccaattact tttaaatgca attgctttga agacaacaca agaagcaatg       240
     aatgcttcct caattgctca tgcggaccaa gaaattgcaa aggcgactgc taatgctatt       300
     ggcgctgtta aacaatcaga gcgtttaaaa gaaacagcta ttgattttgg agctgctgga       360
     caaggctata acccatgtaa ggttctaaat gaacgtagaa caattactga aactcaagaa       420
     agggataaag aaaatagacc agatttaatt tttaaggaaa tttcagcggg aacgggaaaa       480
     tatgcaaatc ctgtagttgc tcaagaacaa acacttaagc ttcatcacga ttatttttgt       540
     acatcagaac aagtatcagc cggcttatgt atgagcgtag gtgaaatgtc tggtgcaaat       600
     ttgcaagcct ctactttatt tgagtattca tcagcgaatg ataagtatgc tattgcaaaa       660
     actagcttca ttaacaatat ggttggtttg ccggatgcac ccttatctgc aaatgcagcc       720
     aaaacgcctc gtggtaaaga atacatgaga cagaaagttg aaaatgatgc agttatttca       780
     ccagctatta atagtttaat ggcaatcaaa tctgaattta ctgaaaaccc taatggtggt       840
     gagtttggtc aacctgttaa accattgcga caacaatatc gggaacaagt agaccgttat       900
     cttggtcatg gtgaagaata taagaattgg aatagaacat tagttgctgc acctgagcgt       960
     ggggtacttg tagagattct taaagaaggt gcattagagc ttgcaatcat gggaaataaa      1020
     catgctcaaa acgaacgtat tgaagcaaat ttagcttctt tagttgcatt agaaaataaa      1080
     aaggcaaact cgcttaataa atctaatata gctggttctg ctaaagctaa ataa            1134
//

If you have problems or comments...

PBIL Back to PBIL home page