(data stored in ACNUC29543 zone)

EMBL: CP000521.PE632

CP000521.PE632       Location/Qualifiers
FT   CDS_pept        710418..711071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3524"
FT                   /old_locus_tag="AS1_3524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3524"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89949"
FT                   /protein_id="ABS89949.2"
FT                   /translation="MNASQTIQTVQFGLDQYSKLVKDLKVLSGIDAFYTAKCLIESFPN
FT                   VVNDEFYGYDFYADEKILDISSYIHIDENKWFNLNCLIDLEEKIVSINLASEMENGEIF
FT                   LFRTDKNYQVAVNYNYSFENFFSLQSNFEYSLFDLVLSSMGLSLLPKKIFNNFELKDIF
FT                   LFSMSIVTGRYKNYIPDQLFFNSIHKNIVLDLKSDELELPSRLINYRDEIDLKW"
     atgaatgcat cacaaactat ccagactgta caatttggtt tggatcaata ctctaaatta        60
     gtaaaagatc tcaaagtctt atccggcatt gatgcattct atacagctaa atgcttgata       120
     gaatcatttc ccaatgtagt taatgatgaa ttttatggct atgattttta tgctgatgaa       180
     aagatcttag atatttcaag ctacatacat attgatgaaa ataagtggtt taatttaaat       240
     tgtctaattg atttagaaga aaagattgtc tcaataaatt tagcttcaga aatggaaaat       300
     ggtgagattt ttctctttcg aacagataaa aattatcagg tggctgtaaa ttataattat       360
     tcattcgaaa atttcttctc actccaaagt aacttcgaat atagtctatt tgatttagtt       420
     ctttcatcga tgggtttatc tttattaccg aaaaaaatat ttaacaactt tgagctgaag       480
     gatatattct tattctcaat gtcgatagtt actggcagat ataaaaacta tattccagat       540
     cagctatttt ttaactcaat acacaaaaat attgttctag atttaaaaag tgatgaatta       600
     gaattaccat cacgattaat taattacaga gatgagatag atcttaaatg gtaa             654
//

If you have problems or comments...

PBIL Back to PBIL home page