(data stored in ACNUC29543 zone)

EMBL: CP000521.PE636

CP000521.PE636       Location/Qualifiers
FT   CDS_pept        715175..717829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11082"
FT                   /protein_id="ABO11082.2"
FT                   /translation="MSIFCPSQTDSTCQNDAAIDLLGKIFGDGFIQAFVLGKSAAATAP
FT                   ATGELTPVLFGALGHLALVFAAFLFLFLVFTSVLHTARDGEVFGAGKKKHWVILRILMS
FT                   GVMILPTTSLYSVSSVVLMMVVLASNGETNKAYREFLNTVVMNPSPSFASVDGLDPYGF
FT                   RAYAIQKLRQYTCVRVLNQNFAAEGVSVGEKKYSDGQTYYVSNIGGERQFNSSLVDRNN
FT                   VLDQGYFGAICGTSSYIVANADSVDSNFKYLTSENPDLESYKDFKKRLLLNIQNLKFQG
FT                   IVRLNEAVLAYVNRLPSEAISPEEYARNFNQAFNNEEFDKIITDEIRRTDASINSHLQS
FT                   NQNSYINKTIQYFAERGWTQVALTKKKLGEFQRDIYEARAKTIYEGTNPDLQRLNREGV
FT                   ASEKERMIYNVLVTQMDSTVNNYLKTPQVVTTLSTNDIQNLIPEDITNSDVSFKQISKD
FT                   VEAANTTLVSNTMRIFIETFTGTGQDDGVDAVTRMQNTGNVLHIALTAVDTTLTGVRTG
FT                   LSAAGATGAVFSDNIGTAAEIVIGLVDYYSEKLGKIMVMGKLVAYYLAVIIPTLPFVFF
FT                   FFAVIGWIIHILQTMVGLILWSVMHMIPEQSFVGSQTQGYLTVVALFFRPMLSLVGFFL
FT                   AFIISDPLLTFTTDGFFAIMGAVQFTNNGFIAALAQFFWLMGWVILYCLILLPIIYLIF
FT                   GLPSSLADSVLAWLGTNLSRSLGETNLGQNVGRAANPAAGYYNTSGGGRGGSGGGSGGN
FT                   GGGGSPAGGGGAGTRGDGSVLMNKGQPNEQSSGAQTHLPNATPSSSNSNWQSAAAAGAR
FT                   EGGIGGAIASSVSFAGRRGLQNEASAGTSVLSDVNAGANQTGYIPTEYRIVPSSASGAN
FT                   SVAPDPVDKKPKN"
     atgagcatat tttgcccttc gcagactgac agtacatgtc aaaacgatgc agcaatagac        60
     ctgctgggaa aaatttttgg tgatgggttt attcaagcat tcgtgctggg taagtccgct       120
     gctgcaactg cacctgctac gggtgaatta acgcctgtac tctttggtgc attaggtcat       180
     ttagccttag tgtttgccgc ttttcttttt ctctttctag tttttacttc cgtattacac       240
     actgcacgag atggtgaagt ctttggtgct ggaaagaaaa aacattgggt aatacttcgt       300
     atcttgatgt ctggtgtcat gattctaccc accacatcat tatattcagt ttccagtgtg       360
     gtacttatga tggttgtatt agcctcgaat ggtgaaacta acaaggcata cagagaattt       420
     ttaaatactg ttgttatgaa cccatcgcca tcctttgctt cagtagacgg tttagatccg       480
     tatggctttc gcgcatacgc aatccaaaag cttcggcaat acacatgtgt acgtgttttg       540
     aatcagaatt ttgcggctga aggtgtttct gtcggtgaaa aaaaatattc ggatggccaa       600
     acttattatg tttctaatat tggaggagaa agacaattta acagctctct agttgacaga       660
     aataatgtct tagatcaggg atatttcgga gcaatatgtg gtacatcctc ttacattgta       720
     gctaatgctg actctgttga ttcgaatttt aaatatttaa catctgaaaa tccggattta       780
     gaatcatata aagatttcaa aaaacgttta ttactcaata tacaaaatct taaatttcag       840
     ggtattgttc gattaaatga agcagtactt gcatatgtaa atagattgcc atctgaagcg       900
     attagtcctg aagagtatgc acgtaatttt aatcaagctt ttaataatga agaatttgat       960
     aaaattatta ctgatgaaat tagacgaact gatgcgtcta ttaactccca cttacagtca      1020
     aatcaaaata gttatattaa taaaacaatt caatattttg ctgaacgtgg ttggacacaa      1080
     gtagctctca ctaagaagaa acttggtgaa ttccagcgtg atatttatga ggctcgcgca      1140
     aaaaccattt atgaaggtac gaatccagac ttacaacgtc ttaacagaga aggcgttgcc      1200
     agtgaaaaag aacgtatgat ttataacgtt ctagtcacac agatggactc tactgtaaac      1260
     aattacctca agacacctca agtagtaaca accctatcaa ctaacgatat tcagaattta      1320
     attcctgaag atataactaa ttcagatgtt tcatttaagc agatctctaa agatgttgaa      1380
     gctgcaaata ccacactagt ttcaaatacc atgagaatct ttattgagac ttttactggc      1440
     actggacaag acgatggcgt agacgctgta actcgtatgc agaacacggg taacgtactt      1500
     cacattgctt taacggctgt agatactact ctaactggcg tgagaactgg tctatctgct      1560
     gctggtgcaa ctggtgctgt tttctcagat aatatcggaa ctgctgctga aattgtcatt      1620
     ggtcttgttg actattattc tgaaaagcta ggcaaaatta tggtgatggg taaactcgtt      1680
     gcctattatc ttgctgtaat tatcccgact ttaccgtttg tattcttctt cttcgctgtt      1740
     attggctgga ttattcatat cctgcaaact atggttggct taatcctttg gtcagtaatg      1800
     catatgatcc ctgaacaaag ttttgttggt agccagacac aaggttactt aactgtagtt      1860
     gccttattct ttaggccgat gctatcgcta gtcggattct tcttggcgtt tattatttcc      1920
     gatcctttat taacatttac tactgatggt ttcttcgcaa tcatgggagc tgtacagttc      1980
     actaataatg ggtttattgc tgctttagct cagttcttct ggctaatggg gtgggtaatt      2040
     ttatattgct taatcctttt accaattatt tatttaattt ttggattacc tagttcgctt      2100
     gcggatagtg tattagcttg gttgggtact aatttatctc gttcacttgg cgagacaaat      2160
     ttaggtcaga atgttggtcg tgctgcaaat ccggctgctg gttactataa tacctctggt      2220
     ggtggacgtg gtggctctgg cggtggttcc ggtggtaacg gtgggggtgg tagtcctgct      2280
     ggtggcggtg gagccggtac acgtggtgat ggatcagtat tgatgaataa agggcagcct      2340
     aatgaacaat catcgggagc tcaaactcac ttacctaatg ctaccccaag ctcaagtaat      2400
     tctaattggc agtctgcggc ggctgctgga gctagagagg gtggtatagg tggtgctatt      2460
     gcttcgagtg ttagcttcgc gggtagacgg ggtcttcaga atgaagcttc ggccggaacg      2520
     agcgtccttt cagatgtaaa tgctggagct aatcaaacgg gttatattcc aactgaatat      2580
     cgtattgtcc catcttctgc ttctggagcc aacagtgttg ctcctgatcc agtggataag      2640
     aagccaaaaa actga                                                       2655
//

If you have problems or comments...

PBIL Back to PBIL home page