(data stored in ACNUC29543 zone)

EMBL: CP000521.PE637

CP000521.PE637       Location/Qualifiers
FT   CDS_pept        718515..720347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11083"
FT                   /protein_id="ABO11083.2"
FT                   /translation="MSAAVIADLHASATNFEYAKPSGQTGKPSNLDAGDFPLTGNLLVT
FT                   SRFGITRFRSDGSPRSHSGLDIINSNGNHSLYAIADGVVIANGWMTGGGNYIRVKRKEN
FT                   NDVYQYLHLATRSPLNIGTEVKKGQYLGTMGNTGISFGTHLHFDYAIPQKEGSRARNAW
FT                   LGSPKGSANANPYQNIQTIGLSKNGIEGYYVTDPTPYLKDDIKITDSTYKNYLGSTIRQ
FT                   QFNILYGANLPVGAGATQPKFAGVQFKLPQGYGATDEQLAKVNISVIEARQKALENGEI
FT                   TEAQAYDPNITYREVEDIFKDSGQVGSSEETKLDIGDDGSVKGHIENLAFKRFASAGWA
FT                   QDLVKASNRSLWVEFLNIEIAKNHLKTQLLKQNERIEALFAAYAIAKARVLQGKIEELR
FT                   QAIENGRNIALISRLELEDLPPIASDTEVMNATVTKRNGSYGLTADKKAAIIAVAQAIG
FT                   ANPNDLAAVISFETAGSFSPSIRNPKGSATGLIQFMQYTDGTGNDKTPRDQWDYWGMTR
FT                   SQFGSLSFTEQMKYVEKYFKDRGLRESKPVSLATLYGLVMGVPKGGYTIARHSAVFRDN
FT                   PAWDVNGDGVITAAEAVNGSKFKAHIRVYFPDFP"
     atgtctgctg ctgttattgc agatttacat gcttcggcca ccaactttga atatgccaaa        60
     ccgtctggtc aaactggtaa accatcaaat ttagatgctg gtgattttcc tttaactggt       120
     aatcttctcg ttacatcacg ttttggtatt actcgatttc gatcggatgg atcaccgcgg       180
     tcacattccg gtttagatat catcaactca aatggtaatc atagtctgta cgcaattgcg       240
     gatggtgtcg ttattgcgaa tggatggatg accggtggtg gtaattatat tcgcgttaaa       300
     aggaaagaaa ataatgacgt atatcagtat cttcatttag ctacgcgctc ccctttaaat       360
     atcggtactg aagtaaagaa ggggcaatat ttagggacaa tgggtaatac cggtatatcg       420
     ttcggtacac atttacattt tgattatgca attccacaaa aagaaggatc ccgtgccaga       480
     aatgcatggc ttggtagtcc aaagggaagc gctaatgcga atccatatca gaatattcag       540
     acaataggtc taagtaagaa tggaatcgaa ggatactacg taactgatcc gacaccatat       600
     ttaaaagatg atataaaaat aacggatagt acctataaaa actatctcgg ttctactatt       660
     agacaacagt ttaatatcct ctatggagct aatttgccag taggagctgg tgcaacacag       720
     ccaaaatttg ctggggttca gtttaagtta cctcaaggat atggagctac tgatgagcaa       780
     ctagcaaaag taaatatttc tgtcattgag gctagacaaa aagctcttga aaatggtgag       840
     atcactgaag cacaagctta cgatccaaac attacttatc gagaagtaga agatattttt       900
     aaagattcag ggcaggtggg gagttctgaa gaaactaaac ttgatattgg tgatgatgga       960
     tcagtaaaag gccacattga aaatttagct ttcaaacgtt tcgcttctgc tggctgggct      1020
     caagatctgg taaaagcttc aaatcgatct ttatgggtcg aatttttaaa tattgaaatt      1080
     gctaaaaacc atcttaaaac acaactttta aagcaaaatg aacgcattga agcacttttt      1140
     gcagcttacg caattgcaaa ggcacgagtc ctacaaggta agattgaaga gttaagacag      1200
     gctattgaaa atggccgtaa tattgcttta atcagtcgct tagagcttga agatcttcca      1260
     ccgattgctt cagatacaga agtaatgaat gcaacagtta caaaacgtaa tggaagttat      1320
     ggtttaactg ctgataagaa agctgcaatt attgcagtcg ctcaggcaat tggtgcaaac      1380
     cctaatgact tagctgctgt tattagtttt gaaacggctg gttcatttag tccaagcata      1440
     cgcaatccaa aagggtctgc aaccggtttg attcaattta tgcagtatac ggacggaact      1500
     ggaaatgata agacgccgcg agatcaatgg gattattggg gcatgacacg ttcacaattt      1560
     ggatcattat catttacaga acaaatgaag tatgttgaaa agtactttaa agatcgtgga      1620
     ttacgtgaat ctaaaccagt tagtttagcg acactttatg gtttagttat gggcgtgccg      1680
     aagggaggat atacgattgc aagacattcg gctgtcttca gagataaccc agcatgggat      1740
     gtgaatggag acggtgttat cacggctgct gaagctgtaa atggatcgaa atttaaagct      1800
     catattcgag tttatttccc tgatttccca taa                                   1833
//

If you have problems or comments...

PBIL Back to PBIL home page