(data stored in ACNUC29543 zone)

EMBL: CP000521.PE638

CP000521.PE638       Location/Qualifiers
FT   CDS_pept        721099..721383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3528"
FT                   /old_locus_tag="AS1_3528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3528"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89953"
FT                   /protein_id="ABS89953.2"
FT                   /translation="MAVNKAHILNNLNPIERSALTSVSESLIAIRVIIRRAQGNGGLSV
FT                   KDIQNIESLADACHNIPSVIANNESEQLKFLLESGTREAKMILAQGAVF"
     ttggcagtaa ataaggcgca tatattgaat aacctgaatc caatagagcg aagtgcgctg        60
     acgtctgtat ctgaaagttt aatcgcgatc agggtaatta taagaagagc tcaaggcaat       120
     ggtgggttat cagttaaaga tattcaaaat attgaatcat tagctgatgc ttgccataac       180
     ataccttcag ttattgccaa taatgagtcg gaacagctca agtttttgct tgagtcgggt       240
     acaagagagg cgaagatgat tcttgctcaa ggagctgtat tttaa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page