(data stored in ACNUC29543 zone)

EMBL: CP000521.PE642

CP000521.PE642       Location/Qualifiers
FT   CDS_pept        725349..726344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11087"
FT                   /protein_id="ABO11087.2"
FT                   /translation="MSDFISTPRLSTYQNILKLTDPNQILRAYYWNIALAGAIYPLMQT
FT                   LEITLRNAIDVSVKNNHQPKSANGSNFVSYKNNDLWFEQLVTAVQDRKITKMRPHQALK
FT                   WVRGGKRIKFSTTESHVKKARDDASTVKSWVKGEDILSRLPFGFWTTLLSKDYEDVTNK
FT                   HLLWPNLLHHVFPNAPSHIKRKDIEDHFNLIREFRNRLSHHEPIWKFYYRNPANNALDY
FT                   TTPIFGLNASLNLLNNQYDDMLMLLQWMSASAYDNFNYSRIGNEFKKLCSIDGFYAYVD
FT                   REKVANCYPASRAKREFFKLAETLQNVNVVYMKTNGKRGYILGLNEPSLP"
     atgagcgatt ttatttctac ccccagacta agcacatatc aaaatatttt gaagctaaca        60
     gatccgaatc agatactaag ggcatattat tggaacattg ctttagctgg agcaatttat       120
     ccgttaatgc agactttgga aattacttta agaaatgcta tagatgtctc agtaaaaaac       180
     aatcatcaac ctaaaagtgc aaatggatct aactttgttt cttataaaaa taatgatcta       240
     tggtttgaac aactggttac agcagtacaa gatagaaaga taactaaaat gcgaccgcac       300
     caagctttga aatgggtgag aggtggaaaa cgtataaaat tcagtaccac ggaaagtcat       360
     gtgaaaaaag cacgtgatga tgcatcaact gtaaaaagct gggttaaagg ggaggatata       420
     ctaagccggt taccttttgg attctggaca actttgctta gcaaggatta tgaagatgtt       480
     acgaacaaac atttactatg gccaaatctt ttgcatcacg tttttccaaa cgcaccttca       540
     catattaaga ggaaagacat tgaagaccat tttaacttaa ttagagaatt caggaaccga       600
     ttatcccacc atgaacctat ctggaagttc tattatagaa atcctgcgaa taatgcatta       660
     gattatacaa caccaatatt cggcttgaac gcttctttaa atctattaaa taatcaatat       720
     gatgatatgt tgatgcttct tcagtggatg tcagcaagtg cttacgataa ttttaattat       780
     tcacgtatag gcaatgagtt caagaaatta tgttctattg atggcttcta cgcttatgtg       840
     gacagggaaa aagttgccaa ttgttatcca gcttcaagag ccaagagaga gttctttaaa       900
     ctcgcagaaa cattacagaa tgtgaatgtt gtttatatga aaactaacgg aaaacgtggg       960
     tatattctag gattaaatga accatcttta ccctaa                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page