(data stored in ACNUC29543 zone)

EMBL: CP000521.PE643

CP000521.PE643       Location/Qualifiers
FT   CDS_pept        complement(726400..727281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3529"
FT                   /old_locus_tag="AS1_3529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3529"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89954"
FT                   /protein_id="ABS89954.2"
FT                   /translation="MSSLLDLVLDGDESKANSAKQTEIELHLIDLDPENPRKTFIEAKE
FT                   KDLEESIRESGVRIPVILIKHPHDDNRFIVKDGNRRVKNSLRAGLQKIPAVVVESFSEL
FT                   DQLTANTMNEDMTIYDISRAIVRLKAKGYSQRQIGKTLAYGDAKVSKIVAITDGLDEEI
FT                   LETLEDMCNRNLLNDFSAMYEIAVLYRDHKVDVRAWVEKQSATAKKIGIAEVQKFKKTF
FT                   ETDLEKDKPKSKEVSLNETVIEDILSKAKESLPLVSKLHKGEIKDPEEREEVVNSLGEL
FT                   IKDLTLILKQYK"
     atgagcagtt tattagattt agttcttgac ggtgatgaat caaaagctaa tagtgctaaa        60
     caaacagaaa tcgaactaca tcttattgat cttgatccag aaaacccacg taaaacattc       120
     attgaagcta aagaaaagga tttagaagaa agtattcgtg aaagcggtgt ccgcattcca       180
     gtaatcctaa ttaagcatcc tcatgatgat aaccggttta ttgtcaaaga cggcaataga       240
     cgggttaaga acagtctgcg agctggcctt caaaagatcc ctgctgtagt ggtcgagagt       300
     ttttcagaac ttgaccaatt aacagctaat accatgaatg aagacatgac tatttatgat       360
     attagtcgtg ctattgttcg cttaaaggct aaaggataca gccaacgtca aatcggtaaa       420
     acgctggctt acggtgatgc aaaagtttca aagattgtag ctatcaccga tgggttggat       480
     gaggaaattc tcgaaactct ggaagatatg tgtaatcgca atctattaaa tgacttctca       540
     gcaatgtatg agattgcagt tttatatcgt gatcataaag tagatgtacg tgcttgggtt       600
     gagaaacaat ctgccacagc taaaaaaatt ggtattgcgg aagtacagaa attcaaaaaa       660
     acatttgaaa cagatctaga aaaagataaa cctaaatcaa aagaagtttc actcaatgaa       720
     actgtaattg aggatattct atcgaaagct aaagaaagct tgcctttagt atcgaaacta       780
     cataagggcg aaatcaaaga tccggaagaa cgtgaagaag ttgtaaattc tttaggtgaa       840
     ctgattaagg atctaacttt aattctgaag caatataaat aa                          882
//

If you have problems or comments...

PBIL Back to PBIL home page