(data stored in ACNUC29543 zone)

EMBL: CP000521.PE649

CP000521.PE649       Location/Qualifiers
FT   CDS_pept        complement(731423..732367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11089"
FT                   /protein_id="ABO11089.2"
FT                   /translation="MKTKSLGNSNKKSSFKFPHVALAALLGFGAAGGWFYYESHNVPTG
FT                   VTSNSTNLYSENLFAQMSKLGQVSNVQPMAGELLAWTMLINGQPQVVFTTKDEKVVITG
FT                   NAFDTATMDSVSLPILQKAQQGGAPANSTGVAAPTGGNVAVDFAEIVGKWDKEVPPSIS
FT                   LLDKLKGAKEGNASAVDTLYIVFDPRCSNCHDAYRATRKYVEKGFSIKWIPTTLLGKHE
FT                   EGAKLAAAVLRDPKQLERAFSKDPNIVVNPTPEEKKALEENVQFLTEATVQSTGSQTIA
FT                   VPTAFYLNKKTGEPKMTTGLSDESILEMIFGKI"
     atgaaaacca aatcacttgg taacagcaat aaaaaatcaa gctttaaatt tccccatgtt        60
     gctttggcag ctctacttgg ctttggtgcg gctggaggat ggttttatta cgaatcacat       120
     aatgttccta caggggtaac ttcaaacagc acaaaccttt atagtgaaaa tctttttgct       180
     caaatgagta agctgggcca agtttctaac gttcaaccta tggctggcga actacttgct       240
     tggaccatgc taattaatgg ccagccacaa gttgttttta caactaaaga tgaaaaagtg       300
     gtcattactg gaaatgcttt tgatacagca acaatggata gtgtaagcct tcctattttg       360
     caaaaagcac aacaaggtgg tgctccagca aattcaaccg gagttgctgc accgactggc       420
     ggtaacgtag ctgttgattt tgccgaaatc gtagggaaat gggataaaga agttcctcct       480
     tctatctctt tactagataa attaaaaggt gcaaaagaag gtaatgcttc agcagttgat       540
     acactgtata tcgtttttga tcctcgttgt tcaaattgtc atgatgccta ccgcgcaaca       600
     cgtaaatatg tagaaaaagg cttttcgatc aaatggattc caaccacgct acttggtaaa       660
     catgaagaag gcgctaaatt ggcggctgct gttcttcgtg atccaaagca actcgaaaga       720
     gcgttctcaa aagatccaaa tatagtggtc aatcctactc ctgaagagaa gaaggccctt       780
     gaagaaaacg tgcaattcct tactgaagca accgtacaaa gtacaggtag tcaaacaatt       840
     gctgttccta cagcatttta cttaaacaaa aaaacaggtg agccaaaaat gactactggc       900
     ttatcagatg aaagcatttt agaaatgatt ttcggaaaaa tctaa                       945
//

If you have problems or comments...

PBIL Back to PBIL home page