(data stored in ACNUC29543 zone)

EMBL: CP000521.PE652

CP000521.PE652       Location/Qualifiers
FT   CDS_pept        complement(734600..735658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11091"
FT                   /protein_id="ABO11091.2"
FT                   /translation="MKGYKTLTVGVDDGHDGIKIYCGEVGKSFRLPSRVANGRTIIGDT
FT                   DEVNKQIIHVNGKYFTVDEFTKEHIDTRTEDYPLSDANVALVHHALHQAFDGQYRKFKI
FT                   ATGLPLNRYYGGKDKAKNEKLIADKTQNLLINKDFNNPTVYNLYEHDKKNDPLQILNHI
FT                   VLSEGQCAYFDALMDDNGKRSSMYEDLWEGGCAIIDIGGRTTDIAMINPRGGTMQASRC
FT                   DTLDVGIITLKNKVSQNLKEFFGLSSNITDWRLSKALKTGIYNHGGKDHDISKILNAAK
FT                   VEITDQIENSIKVNVQDGQDLGAVLLVGGGSITLGDELLKRFNYDNWHLVKQPEFANAR
FT                   GMYKCAKYISKL"
     atgaaaggtt ataaaacttt gacagttggc gtcgatgatg gccatgacgg aatcaagatt        60
     tattgtggtg aagtgggtaa atcatttcgt ctaccaagtc gagtagccaa tggacgcacc       120
     attattggtg ataccgatga agtaaacaaa caaatcattc acgttaatgg caagtatttt       180
     actgtcgatg aatttacaaa agagcatatt gatacacgta ctgaagatta tccgctaagt       240
     gatgcgaatg tcgcacttgt gcaccatgct cttcaccaag cttttgatgg ccaataccgt       300
     aaatttaaaa ttgcaactgg cttaccatta aatcggtact acggtggtaa agacaaagct       360
     aaaaatgaga agttgattgc tgacaaaact caaaatctat tgattaataa ggattttaac       420
     aaccctactg tttacaatct ttatgagcac gacaaaaaaa atgatccttt gcaaatttta       480
     aaccatatcg ttctttctga aggtcaatgt gcttattttg atgctctcat ggatgataat       540
     ggcaaacgct caagtatgta tgaagattta tgggaaggtg gttgtgcaat tatcgatatt       600
     ggtggtcgca ctaccgatat tgcaatgatc aatccccgtg gcggcaccat gcaagcttct       660
     cgctgcgaca ctctagatgt agggataatt actttaaaaa ataaggtaag tcaaaatctt       720
     aaggagtttt tcgggctttc ttcaaatatt acagattggc gactctctaa agccttgaag       780
     accggcattt ataatcatgg cgggaaagat cacgatattt caaaaatctt aaatgctgca       840
     aaggttgaaa tcactgatca gattgaaaac tctatcaaag tgaatgtgca agacggtcaa       900
     gatctaggag cagtgttgct cgttggtgga ggttcaatca cgcttggtga cgagctactt       960
     aaacgattca actatgataa ctggcacctt gtaaaacagc ctgaatttgc gaatgcacgt      1020
     ggcatgtata aatgtgcaaa gtatatttcg aagctttga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page