(data stored in ACNUC29543 zone)

EMBL: CP000521.PE653

CP000521.PE653       Location/Qualifiers
FT   CDS_pept        complement(735943..737232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11092"
FT                   /protein_id="ABO11092.2"
FT                   /translation="MNVYARDTVAEEPKAEHPYQMLRHETIDLDNISINSEEDVRKILT
FT                   VANAFNASDVLINSGRPILIRRYNKLYALTLKNLKDVELNMFLTIINGNEALSSIKKGK
FT                   GLNFAYNCSAFQDRNSKSGKGYITTQNDESWLHVNAVEKEKIIFRCNVSACNDRTGNSS
FT                   FQIVQRIIPSDPPTYDQIGLTEEFVLKAIPRLGITYVVGETGHGKSTTLASMVRYVYEE
FT                   DTHIQGNIITLEEPIEFRYDGIKSKHSIIVQSQIPEHFMTFGLAVREAMRRKPALLLVA
FT                   ELRDQESFSAAIELSKTGHPVMSTIHSNDVANVLPRIMDLVPPDQQHRKLTETISTAHA
FT                   FIAQRLVETPEGKLIGVREHLFFSKSIRNDLLDLAIQAGGYGLVIQYIRKMMNDNPQGT
FT                   ENSSPNFENQAKDLLNKGLISKKGFDALIA"
     atgaatgttt atgctagaga taccgtcgct gaagagccca aagctgaaca cccctatcaa        60
     atgttgcgac atgaaacaat tgatttggat aacatcagca taaattctga agaagatgtg       120
     cgtaaaatct taactgttgc taatgctttt aacgcgagtg acgtattgat caactccggt       180
     agaccaatac tcattcgtcg ttacaataag ctttatgcat taactctgaa gaaccttaaa       240
     gatgttgagc ttaatatgtt tttaaccatt attaatggta atgaagcact aagctcaatt       300
     aaaaaaggga aaggtttaaa tttcgcgtat aactgtagcg catttcaaga tcgcaattcg       360
     aaaagtggta aagggtatat aactacacag aatgatgaaa gctggttaca tgtgaatgca       420
     gtggaaaaag agaaaatcat tttccgctgt aatgtgagtg cctgtaatga tagaactggc       480
     aactcttcct ttcaaattgt tcaacgtatt attccatctg atccacctac ctatgatcaa       540
     atcggcctaa ctgaagagtt cgttctaaaa gccattccga gactaggcat cacttatgtt       600
     gttggtgaaa ctggtcacgg aaaatcaaca acattagctt caatggttcg ttacgtatat       660
     gaagaagata cacatattca gggcaatatt attactcttg aagaacctat cgaattcaga       720
     tacgacggca ttaaaagtaa gcattcaatc attgttcaaa gtcagatacc tgaacatttc       780
     atgacttttg gcctagctgt aagagaagca atgagacgta aaccagcact actactagtt       840
     gctgaattac gtgaccaaga atctttctct gctgcaattg agctctcaaa gacgggacac       900
     cccgttatgt caacaatcca tagtaacgat gttgcaaacg tactacctcg tatcatggat       960
     ttggttccac cagaccaaca acatcgtaaa ttaaccgaaa ctatctctac agcacatgca      1020
     tttattgctc agcgcctcgt tgagacgcca gaggggaaat taataggtgt acgagaacac      1080
     ctctttttct ctaaatccat tcgtaatgac cttttggatc tggctattca ggccggtggg      1140
     tatggacttg ttatccaata cattcgaaag atgatgaatg acaatccaca aggtacagaa      1200
     aactcatcac caaattttga aaatcaggct aaagatttat tgaataaggg actcatcagc      1260
     aaaaaaggct ttgatgccct tatagcctag                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page