(data stored in ACNUC29543 zone)

EMBL: CP000521.PE654

CP000521.PE654       Location/Qualifiers
FT   CDS_pept        complement(737245..738063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11093"
FT                   /protein_id="ABO11093.2"
FT                   /translation="MADLPNYQYYLQQSPIIISQDDSAKQAESSARLESIKTLVHEAAT
FT                   RNALRARLTEIDKVVYNPNNVRKLDSIYDFQRLMINTVVVPPVIVQANNISDVQNPRTL
FT                   SVLGVRYEIKENARFSHTPPNWRDFLQFNVKSYEIGVDALPNELKPKNSAEERAFKEAM
FT                   NKGIEDGVREADAIFKHQLNRLNQTYKGMIAFHRFVMDGKITMPAIARRDIALTGNGNT
FT                   LMLNQTNFEITSLPQFVNNTKLWNSRILSIKERSVVKDPVETPVAIETQQ"
     atggcagatt tacctaatta ccaatattac ttgcagcaat caccaatcat catttctcaa        60
     gatgactctg caaaacaagc tgaaagctca gcccgacttg aatcaatcaa aacactagta       120
     catgaagcag ctacacgaaa tgcattacgt gctcgactga ctgaaattga taaagtcgtt       180
     tacaacccaa acaatgtacg caagcttgat tctatttacg actttcagcg tttaatgatt       240
     aatactgttg ttgttccccc tgtcattgtt caggcaaaca atattagtga tgttcaaaac       300
     cctcgtacac tttcagtgct tggtgtccgt tatgaaatta aagaaaatgc tcgtttctca       360
     cataccccac caaactggcg tgacttttta cagtttaatg tgaagagcta tgaaatcggt       420
     gtggacgcct tacctaacga gttaaaacct aaaaatagtg ccgaagaacg tgcttttaaa       480
     gaagcaatga ataaaggaat tgaagatggt gttcgtgaag cagacgctat tttcaagcat       540
     caattaaacc gtctcaacca aacatataaa ggaatgattg cattccatcg ttttgtcatg       600
     gacgggaaaa ttacgatgcc agcaattgct cgtcgggata tcgcccttac tggtaacggc       660
     aatacactta tgttgaacca gaccaacttt gagattactt ctttacctca atttgtgaac       720
     aacactaaat tgtggaatag ccgaatttta agcatcaaag aacgttcagt cgttaaggat       780
     ccggttgaaa cacctgttgc gattgaaact caacaataa                              819
//

If you have problems or comments...

PBIL Back to PBIL home page